Details for Kale Locus Bo5g132230

Position : C5 ( 5`- 40913407 .. 40915396 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132230

Protein [Map View]
MAAYHQPYDPYYVYNPLPQPLQHFADEPGAINTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFSS
HGFAMAAMNELNGVKFDPQTGSTLHIEVARSNSRRKDRPGSGPYVVIDNRNKETSDDQSDEGESDPYEAQEPGNSNSPKE
IDNTKSEVDSDQDSKAPPTSGRLEKASDGGSGARPCSTLFIANLGPNCTEDELKQLLSRYSGFNILKIRARGGMPVAFAD
FEEIEQATYVMNDLQGNLLSSSDRGGMHIE*

DNA
ATGGCTGCGTATCACCAACCATACGATCCTTACTACGTCTACAATCCTCTCCCACAGCCGCTCCAGCATTTCGCCGACGA
ACCTGGGGCGATCAACACACTCTTCGTCTCCGGCTTGCCTGACGACGTCAAGGCTCGTGAGATCCACAACCTCTTCCGCC
GTCGTCCCGGATTCGAGTCTTGCCAGCTCAAGTACACCGGACGCGGCGACCAGGTAGTTGCATTTGCAACGTTCTCGAGT
CATGGATTCGCCATGGCTGCAATGAATGAGCTAAATGGTGTGAAGTTTGATCCTCAAACAGGATCGACTCTGCATATAGA
AGTAGCTAGATCAAACTCTAGAAGAAAAGATAGGCCAGGAAGTGGGCCTTATGTCGTAATTGATAACAGAAACAAGGAGA
CATCGGACGACCAGAGTGATGAAGGGGAAAGCGATCCTTATGAGGCGCAGGAACCTGGAAATAGCAATTCTCCAAAGGAA
ATTGATAATACCAAAAGCGAAGTGGACTCTGATCAAGATAGTAAAGCACCACCTACTAGTGGGCGTTTGGAAAAAGCATC
CGACGGAGGTTCTGGTGCTCGACCATGTTCCACCTTGTTTATAGCCAATCTAGGGCCTAATTGCACAGAAGATGAACTCA
AACAACTCCTGTCTAGATATTCTGGTTTCAACATCCTGAAAATACGAGCAAGAGGCGGAATGCCAGTTGCATTTGCTGAT
TTTGAGGAAATTGAACAAGCGACTTATGTCATGAATGATCTTCAAGGCAACCTCCTATCCTCTTCAGACCGAGGCGGCAT
GCATATAGAATGA