Details for Kale Locus Bo5g132210

Position : C5 ( 5`- 40909649 .. 40910194 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132210

Protein [Map View]
MTNYGAIPTSSHGSPVVDLDSISRVKQQIKDGLATRRPWRVMFDFHSMGLPRGVSDAFSRIKKNLVYFQTNYAIVFLVVI
FFSLIKHPTSLIVLTVLVFVWIFLYFLRDEPIKLFSYQVDDKTVLVCLSVITIVLLFLTNATLNIAGALLIGAVLVLIHA
VVRKTDDLFLDEEAAMAETLA*

DNA
ATGACAAACTACGGCGCCATTCCGACGTCGTCTCATGGTTCCCCGGTGGTGGATCTCGACTCAATCTCACGCGTCAAGCA
ACAAATCAAAGACGGGCTCGCCACGCGCCGCCCATGGAGAGTGATGTTCGACTTCCACTCCATGGGGCTCCCTCGGGGAG
TCTCCGACGCTTTCTCAAGAATCAAGAAGAACCTCGTCTACTTCCAGACGAACTACGCGATCGTCTTCTTGGTCGTGATC
TTCTTCAGCCTTATCAAGCATCCGACGTCGCTCATCGTCTTGACCGTGTTGGTCTTTGTCTGGATCTTCCTCTACTTCCT
CCGCGACGAGCCTATCAAGTTGTTTAGTTACCAGGTCGATGATAAGACGGTGTTGGTTTGTTTATCGGTGATTACTATTG
TTCTGTTGTTCTTGACCAACGCGACGCTTAATATAGCTGGTGCGTTGTTGATCGGAGCTGTGTTGGTTTTGATCCATGCG
GTTGTTAGGAAGACGGATGATCTCTTCTTGGATGAAGAAGCGGCGATGGCTGAGACTCTTGCCTGA