Details for Kale Locus Bo5g132180

Position : C5 ( 5`- 40891178 .. 40894411 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132180

Protein [Map View]
MDISSSLLLLSFFLFVIIIFIFNKINGLRTSSVSKKKLTEHVSTHSYGPRFPQGSLGWPILGETIEFVSSAYSDHPESFM
DKRRVMYGRVFKSHIFGTATIVSTDAEVNKAVLQSDSTAFVPFYPKTVRDLMGKSSILLINGSLHRRFHGLVGSFLKSPP
LKAQIVRDMHKFLSESMDLWSEDQPVLLQDVSKNVAFKVLAKALISVEKGEELEELKEEFEQFIRGLMSLPINLPGTQLH
RSLQAKKKMVKQVEKIIGDKVRREKNKEEDGAVAKDVVDVLLKDSSENLTHNLIANNMIDMMIPGHDSVPVLITLAVKFL
SDSPTALHFLTEENMELKSLKELTGEQLYWNDYLSLPFTQKVITETLRMGNVIIGVMRKAMKDVEIKGYVIPKGWCFLAY
LRSVHLDKLHYDSPYKFNPWRWQERDMNTSSFSPFGGGQRLCPGLDLARLEASIFLHHLVTRFRWVAEEDTIINFPTVHM
KNKLPIWIKRR*

DNA
ATGGACATTTCTTCATCACTTTTACTCTTGTCCTTCTTCCTCTTTGTCATCATTATCTTCATCTTTAACAAAATCAATGG
TCTCAGAACATCCTCAGTCTCAAAGAAGAAACTTACTGAGCATGTTAGTACTCACAGCTACGGACCAAGGTTCCCACAAG
GAAGCTTGGGATGGCCTATCCTCGGAGAAACCATCGAGTTCGTCTCTTCTGCTTACTCTGACCATCCCGAGAGTTTCATG
GACAAGCGTCGAGTTATGTATGGTAGAGTATTTAAGTCGCATATATTTGGAACGGCCACGATCGTGTCTACGGACGCAGA
AGTTAATAAAGCAGTTTTACAGAGCGACTCCACGGCATTTGTGCCATTCTACCCTAAAACGGTGAGGGATCTCATGGGAA
AATCGTCGATACTTCTGATAAACGGGAGTTTACACCGGAGGTTCCATGGATTAGTCGGTTCGTTCTTAAAGTCACCACCT
CTCAAAGCTCAAATCGTTAGAGACATGCACAAGTTTTTGTCCGAGTCCATGGATCTATGGTCCGAGGACCAACCTGTTCT
CCTCCAGGATGTCTCCAAGAATGTTGCATTCAAAGTACTTGCAAAGGCACTGATAAGTGTAGAGAAAGGAGAAGAGTTAG
AAGAGTTGAAGGAAGAATTTGAACAATTCATCAGAGGACTCATGTCACTGCCAATTAACTTGCCTGGAACCCAACTTCAT
AGATCTCTCCAAGCTAAGAAGAAGATGGTGAAGCAAGTTGAAAAGATCATAGGAGACAAAGTCAGGAGAGAAAAAAACAA
AGAAGAAGATGGTGCGGTTGCAAAAGATGTTGTGGATGTGCTGCTTAAGGACTCAAGTGAAAATTTAACTCACAATTTGA
TTGCTAACAATATGATTGACATGATGATTCCTGGCCACGATTCGGTACCTGTCCTCATCACTCTGGCTGTCAAATTTCTA
TCCGATTCTCCTACAGCTCTTCATTTTCTAACGGAAGAAAACATGGAGCTGAAAAGTTTGAAGGAGTTGACAGGAGAGCA
ACTATATTGGAATGACTATTTGTCTTTACCTTTTACACAAAAGGTCATTACAGAGACACTGAGAATGGGAAATGTTATAA
TTGGAGTGATGCGAAAAGCGATGAAAGATGTTGAAATAAAAGGGTACGTGATACCAAAAGGATGGTGCTTCTTGGCTTAT
CTCAGATCAGTCCATCTTGATAAACTTCACTATGACTCCCCCTACAAATTCAATCCGTGGAGATGGCAAGAAAGGGACAT
GAACACGAGTAGTTTCAGTCCTTTTGGAGGTGGCCAGAGGTTGTGTCCTGGTCTTGATTTGGCCCGTCTTGAAGCTTCAA
TTTTCCTTCACCATCTTGTCACTCGCTTCAGATGGGTTGCAGAAGAAGATACAATTATAAATTTTCCTACAGTGCATATG
AAGAACAAACTACCCATTTGGATCAAAAGAAGATGA