Details for Kale Locus Bo5g132170

Position : C5 ( 5`- 40886253 .. 40887853 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132170

Protein [Map View]
MVILSASSTVRAALDTQPRLPYNPNAPRKVKKTPNGNSFLPPPLPPPPSPRISISVDDLLKRPESKELSEEVVDSYMGYE
TWSPSPPKLEKPRSVFNAASLAFIGDSIYELYARRHFLFPPLSIEDYNDRVRAVVRCEAQYALLKKLVDDDFLTKEERDV
LRWGKNLGSARTRTRRRAGVAVYNKASSLETLIGYLYLTNGKRLEKIMEKLGFSRDSSTEIMIEMAKPKPKPKPSSESNL
PSFILNEQVSTTVV*

DNA
ATGGTGATTTTATCGGCGAGCTCGACCGTGAGAGCTGCCTTGGATACACAGCCTAGACTCCCATACAACCCTAACGCGCC
TCGGAAAGTGAAGAAAACCCCTAACGGCAACTCTTTCTTACCGCCGCCTTTACCTCCTCCTCCGTCTCCGCGAATCAGCA
TCTCCGTCGACGATTTGCTCAAGCGACCCGAAAGCAAAGAGTTGAGTGAGGAAGTTGTTGATAGTTACATGGGGTATGAG
ACGTGGTCTCCGAGTCCACCGAAGCTGGAGAAGCCAAGATCAGTATTCAATGCTGCTTCTTTAGCTTTTATAGGTGATTC
CATCTATGAGCTATATGCTCGTAGGCATTTCCTTTTCCCTCCACTTAGTATTGAAGATTATAACGATCGTGTTAGAGCTG
TGGTGCGCTGTGAAGCTCAGTATGCTTTGCTGAAGAAACTTGTTGATGATGATTTCCTAACAAAGGAAGAGAGGGATGTT
CTCAGGTGGGGGAAGAATCTAGGCTCGGCTAGAACTCGTACAAGAAGGCGTGCAGGTGTTGCGGTTTATAACAAAGCATC
ATCACTGGAGACACTGATTGGTTATCTGTATCTGACGAACGGGAAAAGATTAGAGAAAATAATGGAGAAGTTAGGATTCT
CAAGGGACTCTTCGACTGAGATCATGATTGAAATGGCAAAGCCAAAGCCAAAGCCAAAGCCATCATCAGAATCAAACCTG
CCTTCCTTTATACTCAATGAGCAAGTAAGCACCACAGTAGTATAG