Details for Kale Locus Bo5g132130

Position : C5 ( 5`- 40861523 .. 40862830 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132130

Protein [Map View]
MEIEGEDGTKLILKPGEKAVFGRGAGFTTDDLTVSRRHVSLELKPFAGETDSDRVSLEVLGRNPVWVRKREPGEKIQTFR
KSETGEVKAGDRFCVSGQLPIWFTLKRRDERVSDGESGLDCIDSDPVKEFGFLVIGKEFDQYPKSRIRDVKQWEWFLEDS
TKGNSDDDDEDDGDKKGRKGLSKKRRRGKKRNEEDDDWSAESEEDKELIVKSKRVVSPTRDVNYRVYSTRSKKTKKDVNA
SSSSSSSRAQTKQRGSVDIDEEDEDETLGGFIVSDEEAELEEEDEPNTDDDEEVVEEEDEDEDED*

DNA
ATGGAAATCGAAGGCGAAGACGGCACGAAGCTCATCCTGAAGCCCGGAGAAAAAGCTGTCTTCGGAAGAGGAGCGGGATT
CACCACCGACGACTTAACAGTGTCACGCCGCCACGTCTCTCTCGAGCTAAAACCCTTCGCCGGCGAGACCGATTCCGATA
GGGTTTCGCTCGAGGTTCTCGGTAGAAACCCGGTTTGGGTACGGAAACGCGAACCGGGCGAAAAGATTCAAACTTTTCGT
AAATCTGAGACTGGAGAGGTCAAGGCCGGCGATAGGTTCTGCGTTTCGGGTCAACTCCCTATCTGGTTCACTTTGAAGAG
GCGCGATGAAAGAGTTTCGGATGGTGAAAGTGGATTGGATTGTATCGATAGTGATCCTGTTAAAGAGTTTGGTTTTCTTG
TGATTGGGAAAGAGTTTGATCAGTATCCAAAGAGTCGGATTCGCGATGTAAAGCAGTGGGAATGGTTCCTTGAGGATTCC
ACGAAAGGAAATAGCGATGATGATGATGAGGATGATGGAGATAAGAAGGGAAGGAAGGGATTGAGTAAAAAGAGAAGAAG
AGGAAAGAAAAGGAATGAGGAGGACGATGATTGGAGTGCGGAAAGCGAGGAAGATAAAGAGTTGATTGTCAAATCGAAAA
GAGTTGTGAGTCCAACTAGGGATGTTAACTACAGGGTTTACTCAACTAGATCCAAGAAGACTAAGAAAGACGTAAACGCA
AGTAGCAGCAGCAGTAGTAGCCGTGCTCAGACTAAACAGCGTGGAAGTGTAGATATCGACGAAGAAGATGAGGATGAAAC
ATTGGGAGGTTTCATTGTTAGTGATGAAGAAGCTGAGTTAGAAGAAGAGGACGAACCAAATACAGATGATGATGAAGAAG
TAGTAGAAGAAGAAGATGAAGATGAAGATGAGGATTAA