Details for Kale Locus Bo5g132120

Position : C5 ( 5`- 40859388 .. 40860740 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132120

Protein [Map View]
NLTIKRTFDTKKLSPKVTKRVLFLKDIQVKHDELEEKFLEEKAALEAKYDSLYKPLFDKRYEIVNGVAEAETEKGVPNFW
LIAMKTNEMLANEVQFFIFEYITERDEGALKYLKDIRCCRVENNSRNFKLEFLFDPNPYFKNSVLSKTYHVTDDDDDGPV
LDKVIGTDIEWCPGKCLTHKVVVKKRPKKGSKKVNNIPMTKTENCESFFNFFKPPEIDEVDECYTTMDEELQNLTDQDYD
IAVTIRDKLIPHAVSWFTGEALVDEDEYNDDENDD*

DNA
AACCTAACAATAAAGCGAACCTTTGATACGAAGAAACTCTCTCCTAAAGTTACCAAACGTGTTCTGTTTCTCAAGGATAT
TCAGGTTAAACACGATGAACTCGAGGAGAAGTTTCTTGAAGAAAAGGCTGCATTGGAGGCAAAATACGATAGTCTCTACA
AGCCTCTTTTTGACAAGAGATATGAGATTGTGAATGGTGTGGCTGAAGCTGAGACAGAGAAAGGAGTACCTAACTTCTGG
TTAATTGCAATGAAAACCAACGAAATGCTAGCAAACGAGGTTCAGTTTTTCATTTTCGAATATATAACCGAAAGAGATGA
GGGAGCATTGAAGTATCTCAAAGACATCAGATGTTGCAGAGTAGAAAACAATTCAAGAAACTTCAAGCTTGAGTTTCTCT
TTGATCCTAATCCTTATTTCAAGAACTCGGTTCTGTCTAAAACTTATCATGTGACCGATGACGATGATGATGGTCCTGTT
CTTGATAAAGTGATTGGAACGGACATAGAATGGTGTCCAGGTAAGTGTTTGACTCATAAGGTTGTTGTCAAGAAGAGGCC
AAAGAAGGGTTCAAAGAAAGTGAACAACATCCCCATGACTAAAACCGAAAACTGCGAGAGTTTCTTTAACTTCTTCAAGC
CTCCTGAGATTGATGAAGTTGATGAATGTTATACAACCATGGATGAAGAACTCCAAAACCTGACGGATCAAGACTATGAC
ATAGCTGTGACAATCCGAGACAAACTGATCCCTCACGCAGTTTCATGGTTTACTGGAGAGGCTCTTGTTGATGAAGATGA
ATATAATGATGATGAGAATGATGACTAA