Details for Kale Locus Bo5g132030

Position : C5 ( 5`- 40804435 .. 40806778 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132030

Protein [Map View]
MTSKDMLLHQQVQQQQEENMSNLTSSGDQASVSSGNRTEASGSNFFHHQQQQEEQQQFSVPESQPQKKRRNQPGNPDPES
EVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSNKEAIRKKVYVCPEASCVHHDPSRALGDLTGI
KKHFCRKHGEKKWKCDKCSKKYAVQSDCKAHSKTCGTKEYRCDCGTLFSRRDSYITHRAFCVALAEETAREVVLPQNQNH
QSNPLIIHQSSSHHQAQANMNISSSSSSSHNIINTLHFETNVNNCESSSNHLHTFPMKKEQQQTDDQIINYHHHGVPTWL
SPQPQDLTSSNPSPSNGGGGGGLFSLAASPAMSATALLQKAAQMGSTRTTPLPPTTDFERSHNTLTTTMAAMTSPSGFIT
SNNNNQAFIQDYNASGFNHHHGGEEAFDNTFSGFLRTNADTTTAGSDTNKSGGGGEGLTRDFLGIRPLMSHNEILSFVGL
GNCINDAASDQLHPKPWQG*

DNA
ATGACGAGCAAAGACATGTTACTTCATCAGCAAGTACAACAACAACAAGAGGAGAATATGTCGAATCTAACATCTTCTGG
GGATCAAGCAAGTGTCTCTTCAGGAAACAGAACTGAAGCAAGTGGTTCTAATTTCTTCCATCATCAACAACAACAAGAAG
AGCAACAACAGTTCAGTGTTCCTGAATCTCAGCCTCAGAAGAAGAGGAGAAACCAACCAGGGAATCCAGACCCCGAGTCA
GAAGTGATTGCTTTGTCACCAAAAACACTGATGGCAACAAACAGATTCGTCTGTGAGATCTGCAACAAAGGATTCCAAAG
AGATCAGAATCTACAGCTTCACAGGAGAGGTCACAATCTACCATGGAAGCTGAAACAACGATCCAACAAAGAAGCGATAA
GGAAGAAAGTGTATGTTTGTCCAGAAGCAAGCTGTGTCCACCATGACCCATCTAGAGCTCTCGGTGACTTGACCGGAATC
AAGAAGCATTTCTGCAGAAAGCATGGAGAGAAGAAGTGGAAATGTGACAAATGTTCAAAGAAATATGCTGTTCAGTCAGA
TTGCAAGGCTCATTCTAAGACTTGTGGCACTAAAGAATACAGATGTGACTGTGGCACTCTCTTTTCTAGGAGGGATAGTT
ACATAACTCATAGAGCATTTTGTGTAGCACTGGCAGAAGAGACAGCCAGGGAAGTAGTATTACCACAAAACCAGAATCAT
CAATCAAACCCTCTTATCATTCACCAGTCTTCTTCTCATCATCAAGCACAAGCAAACATGAACATCTCTTCCTCATCTTC
CTCTTCCCACAACATCATCAATACTCTTCACTTCGAAACCAACGTTAATAATTGTGAGAGTAGCAGCAACCATCTACATA
CATTTCCCATGAAGAAAGAGCAACAACAAACCGATGATCAAATCATCAATTACCACCACCATGGCGTCCCTACTTGGCTT
TCTCCTCAGCCGCAAGATCTCACATCTTCAAACCCTAGCCCTAGTAATGGTGGTGGAGGAGGAGGTTTGTTCTCTCTTGC
AGCTTCTCCGGCTATGTCAGCCACAGCATTACTCCAGAAAGCAGCCCAAATGGGTTCCACAAGAACAACTCCTTTGCCAC
CAACCACCGACTTCGAGAGGTCTCATAACACCCTCACCACGACAATGGCGGCCATGACGTCACCGTCGGGATTCATCACT
TCAAACAACAACAATCAAGCCTTCATTCAAGACTACAACGCCTCCGGGTTTAACCATCATCACGGTGGAGAAGAAGCCTT
CGACAACACATTCAGCGGGTTCTTGAGGACAAACGCTGATACCACAACCGCAGGATCAGACACGAATAAAAGCGGTGGAG
GAGGAGAGGGTTTGACGAGAGACTTCTTGGGGATAAGACCGTTAATGTCTCATAACGAGATTCTAAGTTTTGTCGGTCTC
GGGAATTGCATCAATGACGCTGCTTCCGATCAGCTTCATCCAAAGCCTTGGCAGGGTTAG