Details for Kale Locus Bo5g132010

Position : C5 ( 5`- 40789978 .. 40790751 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132010

Protein [Map View]
MPSNKPSSIFPLHHKPTPLKPSSSTNTTNQACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKDLS
PPEKDAAMHTIMFQSDARANDPIEGCYSIIRRLQYEIEYSKNELDMVHHQLAVFRDRAHNHYQEPHMQMQEPEDLSSSCD
LNNNNVVPYSYPLHHVQEPNQQQQQYCSSGNFNGLQEDMWCLQLQESSTTVNMKGGFIDECEDVKPVEEISNEFEHHDGF
VEDSKLDLPSAQFIVSS*

DNA
ATGCCCTCAAACAAACCATCTTCCATCTTCCCTCTACATCACAAACCAACACCATTAAAACCTTCAAGCAGTACCAACAC
CACAAACCAAGCATGCGCTGCATGCAAATACCAACGCAGGAAATGCGCTCCAGATTGTCTTCTCGCTCCTTATTTCCCTC
ACGACCGTCACCGCCAATTCCTCAACGCGCATAAGCTCTTTGGTGTCAGCAACATCACCAAGATCATCAAAGACCTTAGC
CCTCCTGAGAAAGACGCCGCTATGCATACAATCATGTTTCAGTCTGATGCTCGTGCCAATGATCCCATTGAAGGTTGCTA
TAGCATCATAAGAAGGCTTCAGTACGAGATCGAATATAGTAAGAATGAATTGGACATGGTTCATCATCAACTGGCTGTTT
TCCGTGACCGTGCTCATAATCATTATCAAGAACCGCATATGCAGATGCAAGAACCTGAGGATCTCTCGAGTTCTTGTGAT
CTAAACAACAACAACGTGGTTCCTTACAGTTACCCTCTTCATCATGTCCAAGAACCAAACCAACAGCAACAACAATATTG
TTCTTCTGGAAACTTTAATGGGTTACAAGAAGACATGTGGTGTCTTCAACTTCAAGAATCATCAACGACAGTGAATATGA
AGGGTGGCTTCATTGATGAATGCGAAGACGTTAAGCCTGTAGAAGAGATTTCTAACGAGTTCGAGCATCATGATGGTTTC
GTTGAAGACAGTAAACTCGACTTGCCTTCCGCACAATTCATTGTTTCTTCTTAG