Details for Kale Locus Bo5g132000

Position : C5 ( 5`- 40782912 .. 40787901 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132000

Protein [Map View]
MDAACSTQLIDGDGTFNVTGVDHFIKEVKLEECGLSYAVVSIMGPQSSGKSTLLNHLFGTNFREMDAFRGRSQTTKGIWI
ARCAGIEPCTVVMDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMMRLFSPRK
TTLMFVIRDKTRTPLENLEPVLREDIQKIWDSVPKPQAHEETPLSDFFNVEVVALSSYEEKEEQFKEQVYNLRQRFFQSV
APGGLAGDRRGVVPANAFAFSAKQMWQVIKENKDLDLPAHKVMVATVRCEEIANEKFASFIANENWRELEEAAQSGPVSG
FGKKLSSILQSCLSEYDTEATYFEEGVRSSKKQQLQEKLLQLVQPTFQDLLGHLRSGALETFKDAFEKALNAGESFSSSA
DACAQSCISKFDKGCEEAVIEQAKWDTSKTREKFQRDIEAHISSVRTEKLSELTTLYQSKLNVALSGPVEALLDGANDET
WPAIRKLLKREAELAVYGLSDALSGFDMDKETRNKMLTDLENYARGIVETKAKEEAGRALMRMKDRFATIFSHDSDSMPR
VWTGKEDIREITKMARSASLKLLSVMAVIRLDDELDNIEKTLTLALVNSTSNNSTNKSISTIDSLASSTWEQVAPEKTLI
TPVQCKSLWRQFKNETEYTVTQAISAQEANRRNNNWLPPPWAMLALVVLGFNEFMTLLRNPLWLLVLFVGYLVSKALWVQ
LNISEEFRNGALPGLLSLSTKFLPTVMNLLKKLAEEGQVPSTNTNQNSMNSSAQSEVTTNGESSSSSSSSSPVRSVPIDK
SA*

DNA
ATGGATGCTGCTTGCTCTACCCAGCTCATCGATGGAGATGGTACCTTTAATGTTACTGGGGTTGATCATTTTATCAAGGA
GGTTAAGCTGGAAGAATGTGGTCTTTCTTATGCGGTTGTCTCGATTATGGGTCCACAGAGTAGTGGGAAGAGTACGCTCT
TGAATCATTTGTTTGGGACAAACTTTAGAGAAATGGATGCTTTCAGAGGAAGGTCTCAGACGACTAAGGGAATCTGGATT
GCTAGATGCGCTGGTATTGAGCCTTGCACCGTTGTGATGGATTTAGAGGGTACCGATGGGAGAGAGCGTGGAGAGGATGA
TACTGCATTCGAGAAACAGAGTGCTCTTTTTGCACTTGCTGTCTCAGACATAGTTCTCATAAACATGTGGTGTCATGATA
TTGGTCGGGAACAAGCAGCCAATAAACCTCTACTGAAGACTGTGTTCCAGGTTATGATGAGGTTGTTTAGCCCGCGGAAG
ACGACTCTGATGTTTGTCATTAGAGATAAAACACGGACGCCATTGGAAAATTTAGAACCAGTGCTGAGGGAAGACATTCA
GAAGATCTGGGATTCAGTCCCCAAGCCTCAAGCACACGAAGAAACTCCACTTAGTGATTTCTTCAATGTTGAAGTAGTTG
CTCTCTCTAGTTATGAAGAAAAGGAAGAGCAATTCAAAGAGCAGGTCTATAATTTGAGACAACGGTTCTTCCAGTCTGTC
GCACCTGGCGGGCTCGCTGGTGATCGACGAGGAGTTGTCCCTGCCAATGCGTTTGCTTTTAGTGCAAAACAGATGTGGCA
AGTCATCAAAGAAAACAAAGACTTGGACCTTCCAGCACACAAGGTCATGGTAGCAACTGTGCGATGTGAGGAAATTGCCA
ATGAGAAGTTTGCTAGTTTTATTGCGAACGAGAATTGGCGTGAATTAGAAGAAGCTGCACAGTCTGGTCCTGTTTCCGGA
TTTGGAAAAAAACTGAGCTCAATCCTCCAATCTTGCCTATCAGAGTATGACACAGAAGCGACATACTTTGAAGAAGGTGT
AAGATCATCCAAGAAACAACAGCTGCAAGAGAAGTTATTGCAACTTGTTCAACCAACTTTCCAAGACTTGCTTGGGCATT
TGAGATCTGGAGCACTTGAAACTTTCAAGGATGCTTTTGAGAAGGCCTTGAATGCTGGAGAATCCTTTTCATCATCAGCG
GACGCATGCGCCCAGTCTTGCATCTCTAAGTTTGATAAAGGATGTGAAGAGGCTGTTATTGAACAAGCAAAATGGGATAC
ATCTAAAACTCGGGAAAAGTTTCAGCGTGACATTGAAGCCCATATCTCATCTGTCCGTACTGAAAAGTTGTCTGAATTGA
CGACTCTGTACCAGTCAAAACTAAATGTAGCATTATCCGGACCGGTGGAAGCTCTCCTAGATGGAGCTAATGATGAAACA
TGGCCAGCAATAAGAAAGCTATTGAAACGAGAAGCAGAATTGGCTGTCTATGGTCTCTCTGATGCACTATCTGGTTTCGA
CATGGACAAGGAAACACGTAATAAAATGCTCACTGACCTTGAGAACTATGCACGTGGTATTGTTGAAACTAAGGCTAAGG
AAGAGGCTGGAAGAGCGTTGATGCGCATGAAGGATAGGTTTGCTACAATCTTCAGCCATGATTCTGATTCAATGCCACGT
GTTTGGACTGGAAAGGAAGACATCAGAGAAATCACCAAAATGGCTCGTTCTGCATCTTTGAAGCTGCTTTCCGTCATGGC
TGTTATCCGCTTGGATGATGAACTCGACAATATTGAGAAGACATTGACTCTGGCTCTGGTGAATTCTACAAGCAACAATT
CTACCAACAAGAGCATCAGCACAATTGATTCACTCGCGTCAAGCACTTGGGAGCAGGTTGCTCCAGAAAAGACGTTGATC
ACACCTGTACAGTGTAAATCACTGTGGAGACAATTCAAAAACGAGACAGAATATACCGTTACACAGGCTATTTCTGCACA
GGAAGCTAACCGACGGAATAACAACTGGTTGCCACCTCCATGGGCAATGCTTGCCCTGGTCGTTCTTGGATTTAATGAAT
TTATGACTCTCTTAAGAAACCCTCTATGGCTCTTGGTTCTGTTTGTTGGATACCTTGTTTCCAAAGCCTTGTGGGTGCAA
CTAAACATTTCAGAAGAGTTCCGCAACGGAGCGCTACCTGGACTTCTTTCATTGTCAACCAAGTTCCTTCCAACGGTCAT
GAACCTTCTTAAGAAACTCGCGGAAGAAGGACAAGTTCCATCCACAAACACCAACCAAAATTCGATGAACTCCTCAGCTC
AGTCGGAGGTTACAACCAATGGAGAAAGCAGCAGCAGCAGCTCTAGTTCGTCTCCAGTGAGATCCGTTCCCATTGACAAA
AGTGCGTAA