Details for Kale Locus Bo5g131990

Position : C5 ( 5`- 40778623 .. 40779621 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131990

Protein [Map View]
MAAKTLIRSGALLMNRFLSKPTTNLVKNNLRSFQQIAPQGPELPPYFPPSLSNLQRSLYSPPNDTVTLKELTERGFLHPS
GLPSLEFFLPEVDPSSEPLLLFPKRTFQPSTIRRKRNHGFFARKATKGGRRVIARRIAKGRHRVTA*

DNA
ATGGCGGCCAAAACCCTAATCAGGTCGGGAGCTTTGCTGATGAATCGGTTCCTCTCGAAGCCGACGACGAACCTCGTGAA
GAACAATCTCAGATCGTTTCAGCAGATAGCTCCTCAGGGACCAGAACTCCCGCCGTATTTCCCCCCGTCGTTGTCGAATC
TGCAGAGATCGCTCTATTCGCCTCCTAACGATACTGTTACGCTTAAGGAACTCACGGAACGTGGGTTTCTCCACCCATCT
GGTCTCCCTTCCCTCGAGTTCTTCTTACCAGAAGTTGATCCTTCAAGTGAGCCATTGCTTTTATTCCCCAAGAGGACATT
CCAACCTAGCACCATCAGGCGCAAACGTAACCATGGATTCTTTGCTCGCAAAGCAACCAAAGGTGGACGGAGAGTCATTG
CTCGGAGAATAGCTAAAGGGCGTCACAGAGTCACTGCCTAG