Details for Kale Locus Bo5g131980

Position : C5 ( 5`- 40776291 .. 40777417 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131980

Protein [Map View]
MAMDAGALFPNMQAYIYMSLQRCGKSCRLRWINYLRPDLKRGSFSSQEAALIIELHSLLGNRWAQIAKHLPGRTDNEVKN
FWNSSIKKKLMSHHHHGHHLHHHFSSMASLLTPYQNGFNANNSDDEGSRFMSNIIITNTYPNFINPSHVSLPSPHVMAPL
MFPTSTEGDIKFLTTNQSHQDNKLYNNLDILSSTPIINSHHHYDNDSQLPSLPDLPASTICTYQETLQDYDDQGNEVFVT
PYNSNDDDPRSIPLVAAKLLCGQVLEDKILSSSPVSQGHGLLIPTKYNLQMPSESNHHPR*

DNA
ATGGCCATGGATGCTGGAGCTCTGTTCCCAAACATGCAGGCATACATATATATGAGTTTGCAGAGATGTGGAAAGAGCTG
TAGATTAAGATGGATAAATTATTTAAGACCTGATCTTAAACGTGGAAGCTTCTCTTCTCAAGAAGCTGCTCTTATCATTG
AGCTTCATAGCCTTCTTGGTAACAGATGGGCTCAAATTGCCAAACATCTACCTGGAAGAACAGATAACGAGGTCAAGAAT
TTCTGGAACTCAAGCATAAAAAAGAAGCTCATGTCTCACCATCATCATGGTCATCATCTTCATCATCATTTCTCCTCAAT
GGCGAGTTTGCTCACTCCTTATCAAAACGGATTCAACGCTAATAATAGCGACGATGAAGGTTCACGATTCATGTCAAATA
TCATCATCACAAACACTTACCCTAATTTCATCAATCCAAGTCACGTCTCTCTTCCTTCTCCTCACGTTATGGCCCCATTG
ATGTTCCCAACCTCTACAGAAGGAGATATCAAGTTTTTAACCACAAACCAATCTCATCAAGATAACAAGCTCTACAACAA
TCTTGACATTTTGTCATCCACACCAATCATAAATAGTCATCATCATTATGATAATGATTCCCAGTTGCCATCACTACCAG
ATCTCCCAGCGAGTACCATTTGCACTTATCAGGAAACCCTTCAAGATTACGATGATCAGGGCAATGAAGTGTTTGTAACA
CCATACAACAGTAATGATGATGACCCTCGGAGTATTCCATTGGTGGCCGCAAAGTTATTATGTGGACAAGTTCTTGAAGA
CAAAATATTATCCTCCTCGCCAGTTTCACAAGGCCACGGCCTTCTTATCCCCACCAAGTACAACTTGCAAATGCCTAGCG
AATCAAACCATCATCCTCGTTAA