Details for Kale Locus Bo5g131920

Position : C5 ( 5`- 40733850 .. 40738550 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131920

Protein [Map View]
MDPRNPYSRNSGYVGLLNNLQNNNVQDNFPYESYPSSVDIGASENPPFSSQEPEGPSQPEDTPVERLVRRKWTPRDDEVV
ISAWLNTSKDDVIENVHCKQRWHRINDQTNKFCAAFSAAERQITSGQSDNDLLKVAHQIFYADQGHKFTLEHTWCVLRHE
QKWISLNTPTPTGAKRKSGEVNSETAGAHVGEESPQAPVRPEGIKAAKASRNSSKGKAIEDYKSIYELKCEDLARKEKLS
KMAILDTLLAKTSPLSESQETVRGLDYSYTQPSQSDDYGLGNTTESDHCSTEMNIMLDQAEIEASHVQYPPQPEVEFGFP
KECYCGGEPVLRTSITGRRFYSCENIDDGDCHVYKCWEEAATEEIKALGTQYALLSDKIDYIAGVSDYESELNQVKDLHY
QTELKETMLEKTVSDLAKKCYGFELVLEIPYFRPSEDATGRGSLSPLQKCTAAIRQLAYGGAADMVDEYIRLAATTARKC
LHNFTAGIISLFGDEYLRHPTPEDMQRLLYENEERGFPEMIGSIDCTMNDLNILDRSPVFDDVINGIAPQVNYYVNEKEY
HLAYYLADGIYLKWTTFIQSIRIPQTEMQTKFATTQEAVRKDVERAFGVLQARFAGVKNPSKPEVSSSLDQNSNHEATMD
NYYKEPSAATASGNLPAADQTNDYQMKVKKSKSVPNADRGASRSWSFSDPESRRKRRVAGYKVYSVEQKMKGSIRKSFKW
FKDIIGISSK*

DNA
ATGGATCCAAGGAATCCATATAGCCGAAATTCTGGTTATGTGGGGCTTCTTAACAACCTTCAGAATAACAATGTTCAGGA
TAACTTTCCTTATGAAAGTTATCCTTCCAGTGTCGACATTGGCGCCTCTGAAAACCCTCCCTTCAGTTCCCAAGAGCCTG
AGGGTCCATCCCAACCTGAGGACACACCTGTGGAGCGTTTGGTGAGAAGGAAATGGACGCCGCGTGATGACGAGGTGGTG
ATTAGTGCGTGGCTTAACACATCAAAGGACGATGTTATAGAGAATGTTCACTGTAAGCAGAGGTGGCACAGAATCAATGA
TCAAACGAACAAGTTCTGTGCCGCATTCTCTGCTGCAGAGAGACAAATAACCAGCGGTCAGAGTGACAATGACTTACTAA
AGGTGGCTCATCAAATCTTCTACGCTGATCAGGGTCACAAGTTTACCCTCGAACACACGTGGTGTGTCCTGCGGCACGAG
CAAAAGTGGATAAGCCTTAACACACCTACGCCCACCGGTGCAAAGAGAAAGAGTGGTGAAGTGAATTCTGAAACTGCCGG
CGCTCATGTAGGTGAGGAGAGTCCACAAGCACCAGTGCGTCCTGAAGGTATCAAAGCTGCGAAAGCAAGCAGGAATAGTA
GTAAAGGGAAGGCTATTGAGGACTATAAGAGCATTTACGAGCTCAAGTGTGAAGATTTGGCGAGGAAGGAGAAGCTGTCT
AAGATGGCGATATTAGACACTCTCCTTGCTAAGACGAGTCCACTAAGTGAGAGTCAAGAAACCGTCAGGGGTTTGGATTA
TAGCTACACGCAACCGTCTCAATCGGATGATTATGGTTTAGGGAACACAACAGAGAGTGACCACTGCTCGACAGAAATGA
ATATTATGCTCGACCAAGCAGAGATTGAAGCTTCGCATGTTCAATACCCTCCGCAGCCGGAGGTTGAGTTCGGCTTCCCC
AAGGAATGCTACTGCGGTGGAGAACCGGTTCTTAGGACATCTATCACGGGGAGAAGGTTTTACTCATGTGAGAACATCGA
CGATGGAGACTGCCATGTATACAAGTGCTGGGAGGAAGCGGCTACAGAGGAGATCAAAGCTTTAGGTACACAGTATGCTC
TGCTATCAGATAAGATTGATTATATTGCCGGTGTTAGTGACTACGAGTCTGAACTAAACCAGGTAAAAGATCTCCATTAC
CAGACAGAGCTGAAGGAGACTATGCTCGAGAAAACTGTCTCTGATTTGGCCAAAAAATGTTATGGGTTTGAGCTCGTTCT
AGAAATTCCGTATTTCCGACCGTCAGAAGATGCAACCGGACGAGGAAGTCTTTCACCTCTACAAAAATGTACGGCAGCAA
TTCGACAATTGGCATATGGTGGTGCGGCCGATATGGTAGACGAGTATATACGTCTAGCTGCTACAACTGCTCGAAAATGT
TTGCACAATTTTACCGCCGGAATCATCTCCTTGTTTGGCGATGAATACCTACGACATCCCACACCGGAGGATATGCAAAG
ACTTCTATATGAGAACGAGGAACGTGGATTTCCGGAGATGATTGGAAGCATCGACTGTACTATGAACGATCTTAATATTC
TTGATCGATCGCCTGTTTTTGATGACGTTATTAACGGCATCGCGCCACAAGTCAACTATTATGTCAACGAAAAAGAGTAC
CATCTTGCATATTATCTAGCAGATGGTATATATCTGAAATGGACAACTTTTATTCAATCTATCCGGATACCTCAAACTGA
AATGCAGACAAAGTTTGCTACAACCCAAGAAGCAGTTCGTAAAGATGTTGAGCGTGCCTTCGGAGTCTTGCAAGCAAGAT
TTGCCGGTGTCAAAAATCCTTCTAAACCAGAAGTCTCTAGTTCGTTAGACCAAAACTCAAATCACGAAGCCACCATGGAT
AACTATTACAAAGAACCATCAGCAGCAACCGCCTCTGGAAACCTACCAGCTGCCGATCAGACCAACGATTACCAGATGAA
GGTAAAGAAAAGCAAAAGCGTTCCAAACGCTGACCGTGGGGCGTCAAGAAGCTGGAGTTTCAGCGATCCAGAATCGAGGA
GGAAGAGAAGAGTCGCTGGCTATAAGGTTTACTCAGTTGAACAGAAGATGAAAGGATCCATTAGAAAAAGCTTCAAATGG
TTCAAAGACATTATCGGTATTTCTTCAAAATAG