Details for Kale Locus Bo5g131890

Position : C5 ( 5`- 40725272 .. 40728943 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131890

Protein [Map View]
MVYASRIIITHTKKLKHVSTLLRREHAAAVRGFSNSTQPSLTGREDMLKTRLNYSPAERLSKCSARDVPMPSGISTMSTR
PMTGPTFFREYISSQMRSVRGFSSSSDLPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECM
EEGYLAKIVKEEGAKEIQVGEVIAITVEEEEDIQKFKDYTPSSGTPPAAPEAKPAPSPPKEEKVEKPASAPEAKTSQPSS
APSEDRIFASPLAKKLAEDSNVPLSSIKGTGPEGRIVKADVEEFLASRGKETTAKPSKPTDSKVPALDYVDIPHTQIRKV
TASRLAFSKQTIPHYYLTVDTCVDKLMGLRSQLNSFQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFSNV
NINVAVQTENGLYVPVVKDADKKGLSKIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVINPPQAAIL
AIGSAEKRVVAGRGPDQFNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL*

DNA
ATGGTTTACGCATCCCGTATCATCATCACCCATACCAAGAAGCTGAAACATGTTTCCACTTTACTACGGCGTGAGCATGC
TGCGGCAGTCCGCGGTTTCTCCAACAGTACCCAGCCCTCACTCACTGGAAGAGAAGATATGCTCAAGACTCGCCTGAATT
ATTCCCCGGCAGAGAGACTTTCGAAATGTAGTGCCAGAGATGTTCCAATGCCTAGTGGTATTTCAACAATGAGCACAAGA
CCAATGACAGGACCAACCTTCTTTAGAGAATATATAAGCTCCCAGATGCGATCAGTAAGAGGATTTTCATCCAGCTCAGA
TCTTCCTCCTCATCAAGAGATCGGAATGCCTTCTCTTTCCCCAACAATGACTGAGGGTAACATTGCCAGGTGGCTGAAGA
AAGAAGGTGATAAAGTTGCTCCTGGTGAAGTGCTTTGTGAAGTTGAAACTGACAAAGCGACCGTCGAAATGGAATGCATG
GAAGAGGGTTATCTCGCCAAGATAGTGAAGGAGGAAGGGGCAAAAGAAATTCAAGTTGGTGAGGTGATTGCTATCACAGT
TGAAGAAGAAGAAGATATTCAAAAGTTCAAAGATTACACTCCCTCATCTGGTACTCCTCCCGCTGCTCCTGAAGCAAAAC
CAGCTCCTTCCCCACCAAAGGAAGAGAAGGTCGAGAAGCCAGCCAGTGCACCTGAAGCCAAGACATCCCAGCCAAGCTCG
GCTCCTTCAGAAGATCGTATTTTTGCTAGTCCTCTTGCCAAAAAGTTGGCTGAAGATAGTAATGTACCTCTCTCAAGCAT
CAAAGGCACAGGTCCTGAAGGACGAATAGTGAAGGCTGATGTCGAAGAGTTCTTAGCTTCACGCGGTAAAGAAACTACTG
CCAAGCCTTCCAAGCCCACCGATTCAAAGGTTCCAGCTTTGGACTATGTTGATATCCCTCACACTCAAATACGAAAGGTC
ACAGCCTCACGTTTGGCATTCTCAAAGCAAACTATTCCTCACTACTACTTAACCGTGGATACATGTGTTGACAAACTGAT
GGGCCTTAGGAGTCAACTGAATTCATTTCAAGAGGCGTCCGGCGGGAAACGGATATCAGTTAACGACCTTGTTATTAAGG
CTGCTGCATTGGCTCTAAGGAAAGTTCCACAGTGTAATAGTTCATGGACAGACGAATACATCCGCCAATTTAGCAATGTG
AACATCAACGTGGCAGTACAAACAGAAAATGGGCTTTACGTTCCTGTTGTCAAGGACGCGGACAAGAAAGGGCTGTCCAA
AATTGGAGAAGAGGTTAGATTCTTGGCTCAGAAAGCTAAAGAAAACAGCTTGAAGCCTGAAGATTATGAGGGAGGAACAT
TCACAGTCTCCAACTTGGGAGGACCTTTTGGCATCAAACAGTTCTGCGCAGTCATCAATCCACCTCAAGCCGCTATTCTA
GCAATCGGATCAGCTGAAAAGAGAGTTGTTGCTGGTAGAGGCCCTGACCAGTTTAACGTGGCTTCGTACATGTCTGTAAC
ACTTAGCTGTGATCACCGTGTAATAGATGGTGCCATTGGAGCTGAATGGTTGAAAGCATTCAAGGGTTATATCGAGACCC
CAGAATCTATGTTGCTCTAA