Details for Kale Locus Bo5g131880

Position : C5 ( 5`- 40720466 .. 40721579 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131880

Protein [Map View]
MEVNGGEDQYEEASEWFVKYLNRQGDWLEKTRGNLMVAATVIAGMSFQVMVSPPGGVWQSDICSSGNQTGVTVPVCTAKA
GTSVLEHESSKRGLYLGMVISSTVSFSASMSLILLVISGLRLRNRMIMAILVTFMVLAVLCISAAFFFAVALVQYEDDKI
IYILMFYVGFWIVFPVIILVSQLVRFLGWLICFVCCCCPRRRRSPRRLLPVTPSPVH*

DNA
ATGGAAGTTAACGGTGGAGAAGATCAATACGAAGAAGCATCAGAGTGGTTTGTGAAGTATTTAAATCGTCAAGGTGATTG
GTTAGAAAAGACCAGAGGAAATCTAATGGTTGCAGCGACAGTTATAGCTGGTATGAGCTTTCAAGTTATGGTTAGTCCTC
CTGGTGGTGTATGGCAGAGTGATATTTGTTCTTCCGGTAATCAAACCGGTGTTACCGTACCGGTTTGTACGGCAAAAGCG
GGAACTTCGGTATTGGAGCACGAGAGTTCGAAACGTGGACTCTATCTTGGAATGGTTATTAGTAGTACAGTTTCGTTTTC
TGCCTCCATGAGCCTCATTCTACTTGTCATCAGTGGATTACGACTCAGGAACCGGATGATAATGGCGATCCTAGTGACAT
TTATGGTACTAGCGGTTCTTTGCATATCGGCGGCGTTTTTCTTCGCTGTCGCATTGGTTCAGTATGAAGATGATAAAATC
ATCTATATACTAATGTTTTATGTGGGATTCTGGATCGTGTTTCCTGTTATAATACTTGTAAGCCAACTAGTTCGGTTTTT
AGGTTGGCTTATTTGTTTCGTATGTTGTTGTTGTCCACGTCGACGACGGTCCCCTCGACGGCTGTTGCCAGTGACTCCAT
CTCCTGTCCATTAA