Details for Kale Locus Bo5g131850

Position : C5 ( 5`- 40709850 .. 40710883 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131850

Protein [Map View]
MATTESPSSVRKIVVHLRATGGAPILKQNKFKISGTDKFAKVIDFLGRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGI
DGKLVVNYACSMAWG*

DNA
ATGGCGACGACGGAGTCGCCGAGCTCCGTTCGGAAAATTGTTGTTCATCTAAGAGCTACAGGAGGTGCTCCAATACTGAA
ACAAAATAAGTTCAAGATTTCAGGGACGGATAAGTTTGCTAAAGTGATTGACTTTCTAGGAAGGCAGCTTCACTCTGACT
CATTGTTTGTGTATGTAAACAGTGCTTTCTCGCCGAACCCTGATGAATCAGTGATTGATCTATACAATAACTTTGGGATA
GATGGGAAACTGGTGGTGAATTATGCTTGTTCCATGGCATGGGGATAA