Details for Kale Locus Bo5g131830

Position : C5 ( 5`- 40693893 .. 40695020 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131830

Protein [Map View]
METWEKPRVSSSRDHYRQPSFSSTLLDQIYRSIDDSPPLESTRRKKQQHRNIALQDTSASDKLVFHRCSIAADYERSRRT
TSLADSVFLRYSNSSSSDSSGFSSSELDSFYLRSKPSASPPRTRQPKPIRTSVVEKFDHSVNVQKPSSKQEHGGFLRTKS
KALKIYTDLKKVKQPLSPGGRLATFLNSLFTNASSNHKKLKKINTTVSSSAEQPPQSSSNTTCSSTSSFSRSCLSKTPSS
SGKSKRSVRFCPVNVILDEDSSIHIPYGYSNKLHGNNVDRHVMEEENRRVIEAAKDLIRTYQKNKDHLAVTTCDNVQEDD
EDDIDDDAASYASSDLFELENLSAIGIERYREELPVYETTRLDNTNRAIATSLIV*

DNA
ATGGAGACTTGGGAGAAGCCTAGAGTTTCATCTTCAAGAGATCACTACCGTCAACCTTCCTTCTCCTCCACTCTCCTCGA
CCAAATCTACCGCTCCATCGACGACTCCCCTCCCCTAGAATCCACTAGAAGGAAGAAGCAGCAGCACCGTAACATAGCTC
TCCAAGACACTTCTGCTTCAGACAAACTCGTATTTCACCGCTGCTCCATCGCCGCTGACTACGAGAGATCCCGGCGAACG
ACCAGCTTAGCCGACTCCGTTTTCCTCAGATATTCCAACTCCAGCTCCTCTGACTCAAGCGGGTTCTCCTCCTCCGAGCT
AGACTCCTTCTACCTACGCTCCAAACCCTCTGCCTCTCCTCCACGCACTCGTCAACCCAAGCCGATTCGAACCTCCGTCG
TGGAAAAGTTCGACCACTCCGTCAACGTACAGAAACCTAGCAGCAAACAAGAGCACGGTGGTTTCTTGAGAACCAAGTCA
AAGGCCTTAAAGATCTACACAGACTTGAAAAAAGTGAAACAACCTCTCTCTCCCGGAGGACGGCTCGCTACTTTCCTCAA
CTCTCTCTTCACAAACGCATCAAGCAACCATAAGAAGCTAAAGAAAATCAACACCACCGTCTCTTCCTCAGCGGAGCAGC
CACCACAGTCCTCCTCCAACACCACATGCTCCTCCACGTCCTCTTTCTCCAGATCTTGCTTAAGCAAAACTCCATCGTCC
AGCGGGAAATCCAAAAGATCCGTGAGGTTCTGTCCAGTGAACGTTATCCTCGACGAAGACTCCTCCATCCACATCCCTTA
CGGTTATAGTAACAAGCTGCATGGAAACAACGTCGACCGCCACGTCATGGAGGAGGAGAATCGCCGCGTTATCGAAGCGG
CTAAGGATCTTATTAGGACGTACCAAAAGAACAAGGATCATTTGGCCGTGACAACGTGCGACAACGTTCAAGAAGATGAC
GAGGATGATATTGATGATGATGCGGCGAGTTACGCGAGCTCTGATCTGTTCGAGTTGGAGAATCTTTCGGCTATTGGGAT
CGAGAGGTATCGAGAAGAGTTACCAGTCTACGAGACCACTCGTTTGGATAATACGAATCGAGCTATTGCTACAAGTTTAA
TTGTATAA