Details for Kale Locus Bo5g131810

Position : C5 ( 5`- 40669146 .. 40673651 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131810

Protein [Map View]
MVSGSRAGGNRAMDDEERKLIESIREIVGNHTDADIYAALKEADMNADEAVQKLIHQDPFHEVKRRRDRKKEVAVLVEPA
DEKKPLESVTSEVNVLTQPEHNARRGGYSRNVFPRNAAPRDDFHRNTAPRNELPRNAAPRNEFPRNAAQQNEFPGNPAPR
NAFPRNAAPRNAFPRNPATGSKREFRVVRDNRSNPNVGEELKHTSAHQSSGLNISKVTASQNQKGLTGGFGNRRSPGSQD
FSEDCNASADVRLRDTEIAPLHHPTRKELSDGKQTARSGTLPSTNSVIGVYPSSIDPVHVPSPVSRSSPVGAIKREVRGG
GFGGKPSENVGKDPSASTGSLSGSSIRKIGTPNAHRSSSPNSKIDQVSQTTLRESVLPIGGEKNRPVLNRQRGNRGSQYG
RTQQVGGHTKGVSQNKEWKPKPIQKSVGHNPGVIGTPAKSQACRSDDISLNLESEAVKVQDKLSHVHISESQNVIIADHI
RVPETDRCQLTFGSFVQEFSSSVNSESAFQESCSLEELRETDRSSPVSPPETVTDGPGDKPIDILDDHVRVSESDSRVPV
ASEHQLPEEKEAHRSDNLDEYSEIQLLSRNGPHYTPLEFEEQQDPPELQKPPAYGNHGSYDSPYENVRGQGLPSQQEVLS
TQMVNNGPSSTIPMLQQQQQQQQQASMQQMYPQVQVAHFPNLMPYRQFVSYVPQMPMPGYSGNPTAYAHPSNGNSYVLMP
GGGSHPGSNGVKYGIQQFKPVPTGGPTGFGTYNNNPSAYQINTPNVVGNAMGLEDPSRMKYKDGNIYVQNPQQAETSDIW
MQNPRDLSSLQSPPYYNVAGQTPHGAYLPSHTSHPSFNASAQSPQMQFQGLFHPPQPGAMANQHHMGPGLGGNVGVVPSP
PSQLGAYQQSQLGHPNWGANF*

DNA
ATGGTGTCTGGGTCCAGAGCCGGCGGTAATCGGGCGATGGATGATGAAGAGAGAAAGCTGATTGAGTCGATTAGAGAAAT
CGTGGGTAATCACACCGACGCCGATATCTACGCCGCCTTGAAAGAAGCTGACATGAACGCCGACGAGGCTGTGCAGAAGC
TGATTCATCAAGATCCGTTCCATGAGGTGAAGAGAAGAAGAGACAGGAAGAAAGAGGTTGCAGTATTGGTTGAGCCTGCC
GACGAAAAGAAACCTCTTGAAAGTGTTACCAGTGAAGTGAACGTTCTTACACAGCCTGAGCATAATGCTCGGAGAGGAGG
CTACAGTAGGAATGTCTTCCCTAGGAACGCTGCTCCACGAGATGATTTTCATAGGAACACTGCTCCGCGAAATGAACTTC
CTAGGAACGCTGCTCCACGAAATGAGTTTCCTAGGAACGCTGCCCAACAAAATGAGTTTCCTGGGAACCCTGCTCCACGT
AATGCCTTTCCTAGGAACGCTGCTCCACGAAATGCATTTCCTAGGAATCCTGCTACTGGATCCAAGAGAGAGTTTCGCGT
TGTTAGAGACAACAGGTCTAATCCAAATGTTGGTGAAGAGTTGAAGCATACTTCCGCCCACCAGTCTTCTGGATTAAATA
TTAGCAAAGTAACGGCCTCTCAAAACCAAAAGGGCTTAACAGGTGGTTTTGGCAATCGTCGATCTCCTGGGAGTCAAGAT
TTTTCCGAAGATTGTAATGCATCAGCAGATGTCAGGCTCAGAGATACTGAAATTGCTCCATTGCACCATCCAACCAGAAA
AGAACTCTCTGATGGAAAGCAGACGGCACGTAGTGGTACCCTGCCATCAACCAATTCAGTTATTGGTGTATATCCGTCTT
CCATAGATCCAGTTCATGTACCATCTCCTGTTTCTAGATCATCACCTGTGGGCGCTATTAAACGTGAAGTAAGAGGTGGA
GGCTTTGGTGGAAAACCTTCTGAAAATGTTGGTAAAGATCCATCTGCATCTACGGGTTCTTTGTCAGGGTCCTCGATTAG
AAAGATTGGGACTCCAAATGCACATCGATCATCTTCCCCAAATTCAAAGATTGATCAAGTCAGTCAAACTACTTTACGAG
AGTCTGTTTTACCCATCGGTGGGGAAAAGAATAGACCTGTTTTGAACAGGCAGCGTGGAAACAGAGGAAGCCAATATGGT
AGAACACAACAAGTTGGTGGTCATACAAAAGGAGTCTCACAGAACAAGGAATGGAAGCCTAAACCAATTCAGAAATCTGT
TGGACATAACCCTGGAGTAATTGGAACACCTGCAAAGTCTCAGGCTTGTCGTTCGGATGATATTTCCTTAAATTTGGAAT
CGGAGGCTGTTAAGGTGCAAGATAAGCTTTCGCATGTTCATATCAGTGAAAGCCAGAATGTCATCATCGCAGATCATATT
CGCGTCCCAGAGACTGACCGATGTCAGCTTACTTTTGGTAGCTTTGTTCAAGAGTTTAGTTCTTCAGTGAATTCAGAATC
TGCTTTCCAGGAATCATGCTCTTTAGAAGAACTTAGAGAAACTGATCGTAGTTCGCCAGTTTCTCCTCCAGAGACTGTAA
CAGATGGTCCTGGGGATAAGCCTATCGATATTCTTGATGATCATGTCAGAGTTTCTGAATCTGACTCACGTGTACCAGTG
GCGTCTGAGCATCAGTTACCCGAAGAGAAGGAGGCTCACAGATCTGACAATTTGGATGAGTACTCGGAAATTCAATTGCT
CAGTAGGAACGGTCCACATTATACTCCTCTAGAGTTTGAAGAGCAGCAAGATCCTCCTGAGTTGCAAAAACCTCCTGCAT
ATGGTAATCACGGTAGTTATGACTCTCCGTATGAAAACGTACGAGGACAAGGATTACCATCTCAGCAAGAGGTGTTAAGT
ACTCAAATGGTGAACAATGGCCCTTCATCTACGATTCCCATGCTGCAGCAGCAGCAGCAACAACAACAGCAGGCGTCAAT
GCAACAGATGTACCCGCAGGTTCAAGTTGCACATTTTCCCAATCTGATGCCTTATCGTCAGTTCGTCTCCTATGTTCCCC
AGATGCCCATGCCAGGCTACTCAGGTAACCCAACAGCGTATGCACACCCTTCAAATGGAAATAGCTATGTTCTGATGCCT
GGAGGTGGTTCTCATCCTGGCTCAAACGGTGTCAAGTATGGCATCCAGCAATTCAAGCCAGTCCCAACAGGTGGTCCTAC
TGGTTTTGGGACTTACAACAACAACCCTAGTGCGTATCAGATTAATACTCCCAATGTAGTTGGAAACGCCATGGGTCTTG
AAGATCCATCTCGCATGAAATACAAAGATGGGAATATCTACGTTCAAAACCCTCAGCAGGCTGAGACTTCTGATATTTGG
ATGCAGAATCCAAGAGATCTTTCAAGCCTTCAGTCTCCTCCATATTACAACGTAGCTGGTCAAACGCCTCATGGTGCTTA
TTTACCATCCCATACATCACATCCATCCTTCAACGCCTCTGCACAATCTCCTCAAATGCAGTTCCAGGGTCTCTTCCATC
CCCCACAACCTGGTGCAATGGCGAATCAACACCACATGGGACCTGGGCTTGGTGGTAATGTTGGGGTTGTGCCCTCTCCT
CCCTCTCAACTTGGTGCTTATCAGCAATCACAACTTGGTCATCCCAATTGGGGAGCAAACTTCTGA