Details for Kale Locus Bo5g131790

Position : C5 ( 5`- 40657690 .. 40659829 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131790

Protein [Map View]
MLTCIACSKQVNTNNGGSKDEEEDDDRTPRSKQAIKSLTSQIKDMAVKASGAYKSCKPCSGSLNRNSDAASASGRFHYAY
KRPGISRSGSSTPKILGKDMESRLKGLLSGEGTPESVSGRTESTVFLEEEEEDEPKEWVAQVEPGVLITFVSLPEGGNDL
KRIRFSREMFDKRQAQKWWAENFEKVMELYNVQQFNQQSVPFPTPPASKDESSSKNGPATPPLNNECPRGKGSLAHQLKP
QTQSRYRSDSSGLATTPKLSSISGTKTETSSVVGSARSSRLSREDEEEEDAEEVSVSNASDNETEWVEQDEEGVYITIRA
LPDGTRELRRVRFSRDRFGETNARLWWEENKARIQQQYL*

DNA
ATGCTCACGTGCATAGCTTGTTCGAAGCAGGTAAACACCAACAATGGCGGATCTAAAGATGAAGAAGAAGATGATGACAG
AACGCCCAGGTCTAAGCAGGCCATTAAGTCCCTGACGTCACAGATAAAAGACATGGCAGTGAAAGCTTCAGGCGCTTACA
AAAGCTGCAAACCGTGTTCGGGTTCTTTAAACCGGAACTCGGATGCTGCATCAGCTTCCGGGAGGTTCCATTATGCGTAC
AAGAGACCTGGAATCAGCAGAAGCGGAAGCTCTACTCCTAAGATTCTAGGGAAAGATATGGAGTCAAGGCTAAAAGGGCT
TTTGAGTGGAGAAGGAACACCTGAGTCCGTGAGCGGCAGGACAGAGTCTACAGTGTTCTTGGAGGAAGAAGAAGAAGATG
AGCCTAAAGAATGGGTTGCTCAAGTTGAGCCTGGTGTCCTCATCACCTTTGTTTCTTTGCCTGAGGGAGGCAACGATCTC
AAGCGTATTCGTTTCAGTCGTGAGATGTTTGATAAGCGGCAAGCTCAAAAATGGTGGGCGGAGAATTTCGAGAAGGTCAT
GGAGTTGTACAATGTGCAGCAGTTTAATCAGCAGAGCGTCCCGTTTCCAACTCCTCCTGCATCCAAAGATGAGAGCTCTT
CCAAGAACGGTCCTGCAACTCCACCTCTAAACAATGAATGCCCTCGCGGAAAAGGGTCACTCGCTCACCAACTAAAACCA
CAAACACAAAGTCGGTACCGAAGTGATTCGTCTGGTCTTGCGACGACGCCAAAACTCTCTAGCATAAGTGGCACCAAAAC
TGAGACATCATCGGTTGTTGGGTCCGCAAGAAGTAGTAGGTTATCAAGGGAAGACGAAGAAGAAGAAGATGCAGAAGAGG
TCTCAGTAAGTAATGCGAGCGACAACGAAACAGAATGGGTGGAACAAGACGAAGAAGGTGTTTACATCACAATCAGAGCT
TTACCAGATGGGACTCGCGAGCTTAGACGTGTTCGCTTCAGTCGAGATAGGTTTGGGGAAACGAATGCAAGATTGTGGTG
GGAAGAGAACAAAGCTCGGATACAACAGCAGTACTTGTGA