Details for Kale Locus Bo5g131760

Position : C5 ( 5`- 40630266 .. 40632786 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131760

Protein [Map View]
MVMATTISIYASPPSSACSTPHQIAASDLDLASRNLSTSPSQKPIVVGGLSSLFSGASVKSSASIGVEEFSRHDRSEDYR
DLSFTSSLCYSPARFVASSYHHRREHHQSPISVLHGPVSCSCSPPMRIGTSHRAGGANGLFSRFVRKAVGSCVDYELGPS
DELTLFPMEDGSETKQPYAMDLLRRAQLRHKIFEDECVIKAFYEAEKAHRGQMRASRDPYLQHCVETAMLLANIGANSTV
VVAGLLHDTMDDSFMTYDYILRNFGAGVADLVQGVSKLSQLSKLARENNTACKTVEADRLHTMFLAVADARAVLIKLADR
LHNMMTLYALSPVKQQRFAKETLEIFAPLANRLGISKWKVQLENLCFKHLYRHQHDEMSTMLEDSFDEAMITSAIEKLEQ
ALEKEGISYHVLCGRHKSLYSIYRKMLKKNLTVDEIHDIHGLRLIVNNEGDCYKALGVVHSLWSQVPGKLKDYITHPKFN
GYQSLHTVVMDNGTVPLEVQIRTQEMHLQAEFGFAAHWRYKEGDCEYSSFVLQMVEWARWVVTWHCETMSKDRSSICSSD
SIKPPCKFPSHSEDCPASYKPNSSQDGPVYVIVIENDKMSVQEFPASSTVSDLLSGAGPGSSRWSMYGIPAKEELRPRLN
QRPVSDLKWKLKMGDVVELTPPIPDESLPEYREEIQRMYDRGLAFSRPGTMVGWGS*

DNA
ATGGTGATGGCTACGACTATATCAATTTACGCTAGTCCACCTAGCAGCGCGTGCTCCACGCCGCACCAGATCGCCGCTTC
TGATCTCGATCTCGCCTCCAGAAATTTGTCGACATCTCCTTCGCAGAAACCGATCGTCGTCGGAGGTCTCTCTTCGCTCT
TCTCCGGCGCCTCCGTCAAATCTTCAGCTTCCATCGGAGTAGAGGAGTTTTCGCGTCACGATCGGAGCGAGGATTATAGA
GATCTGAGCTTTACGAGCTCCTTGTGTTATTCTCCGGCGAGATTCGTCGCTTCCTCTTATCATCACCGACGAGAGCACCA
CCAAAGCCCGATCTCCGTGCTTCACGGTCCCGTCTCGTGCAGCTGCAGCCCTCCGATGAGAATCGGAACCTCCCACCGCG
CAGGAGGAGCCAACGGATTGTTCAGTAGGTTCGTGAGGAAAGCCGTCGGCTCGTGTGTTGATTACGAGCTGGGACCGTCG
GATGAGCTAACGTTGTTTCCCATGGAGGATGGATCAGAGACGAAACAGCCGTACGCTATGGATTTGCTGAGACGTGCTCA
GCTAAGGCACAAGATCTTCGAAGATGAGTGTGTGATCAAAGCGTTTTACGAGGCAGAGAAAGCTCATAGAGGACAGATGA
GAGCTAGTCGTGATCCTTACCTTCAACATTGTGTTGAGACTGCTATGTTGTTGGCTAACATCGGAGCTAACTCGACCGTT
GTCGTCGCCGGACTTCTTCACGACACCATGGACGATTCATTCATGACCTACGATTATATCCTCAGAAACTTTGGAGCTGG
AGTTGCTGATTTGGTCCAAGGGGTTTCAAAGCTTAGCCAACTAAGCAAACTCGCTAGAGAGAACAACACCGCGTGTAAAA
CCGTCGAAGCTGATAGATTGCATACAATGTTTCTCGCAGTGGCCGATGCGAGAGCTGTTCTCATCAAACTAGCAGATCGT
CTCCACAACATGATGACGCTTTACGCTTTGTCCCCAGTGAAGCAGCAGAGGTTCGCTAAAGAGACTCTCGAGATCTTCGC
GCCTTTGGCTAACCGATTAGGAATCTCTAAATGGAAAGTTCAGCTTGAAAACCTCTGTTTCAAGCATCTTTACCGGCACC
AGCATGACGAGATGTCAACCATGCTCGAGGATTCGTTCGACGAAGCCATGATTACTTCTGCTATAGAGAAACTGGAGCAA
GCTCTGGAGAAAGAAGGCATTTCTTACCATGTTCTGTGTGGTCGGCACAAGAGTTTGTATAGTATTTACCGCAAGATGTT
GAAGAAGAATCTAACGGTGGATGAGATTCATGACATTCATGGGTTACGTTTGATTGTTAACAACGAAGGAGATTGTTACA
AGGCCTTAGGAGTAGTTCATAGTTTATGGTCTCAAGTTCCTGGGAAGCTCAAGGATTACATAACTCATCCCAAGTTCAAT
GGGTATCAATCTTTGCACACGGTAGTGATGGACAATGGAACGGTTCCACTTGAAGTCCAGATACGTACACAAGAGATGCA
TTTGCAAGCTGAGTTTGGGTTTGCAGCTCATTGGAGGTACAAGGAAGGTGACTGCGAATACTCTTCGTTTGTACTTCAGA
TGGTTGAATGGGCTCGGTGGGTTGTAACGTGGCACTGCGAAACTATGAGCAAAGACCGGTCTTCCATTTGTTCTTCTGAC
TCCATCAAACCCCCTTGCAAGTTTCCTTCTCACTCTGAGGACTGCCCTGCTTCTTACAAGCCTAACAGTAGCCAGGACGG
GCCAGTCTATGTCATCGTAATCGAAAATGACAAGATGTCTGTGCAAGAGTTTCCAGCGAGTTCAACAGTCTCGGATCTGC
TGAGCGGGGCGGGGCCTGGGAGCTCGAGGTGGTCCATGTATGGCATACCAGCAAAGGAGGAGCTACGGCCTAGGCTGAAC
CAGAGGCCTGTAAGCGACCTCAAGTGGAAGCTGAAGATGGGTGATGTGGTGGAGCTAACTCCACCAATACCTGATGAGTC
TCTGCCTGAATACAGAGAAGAGATTCAACGGATGTATGACCGAGGGCTCGCGTTTTCTCGCCCTGGGACCATGGTTGGAT
GGGGAAGCTGA