Details for Kale Locus Bo5g131750

Position : C5 ( 5`- 40622393 .. 40624719 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131750

Protein [Map View]
MAKLSLSSVFFVFPLFLCSFSSLSSWDGLESYIVHVQSSHKPSLFSSHDHWHNSLLRSLPSSPQPATLLYSYSRAVQGFS
ARLSPTQTADLRRHPSVISVIPDQAREIHTTHTPAFLGFSDNSGLWSNSNYGEDVIVGVLDTGIWPEHPSFSDSGLDPVP
STWKGACETGPDFPASSCNRKLIGARAFYKGYLTHRNGTVRAAKESRSPRDTEGHGTHTASTAAGSVVANASLYQYARGV
ARGMASKARIAVIKSVGQAVADGVHVISLSVGANGYAPEYHMDSIAIGAFGATRHGIVVSCSAGNSGPGPQTATNIAPWI
LTVGASTTDREFSANAITGDGKVFTGTSLYAGEPLPDSQLSLVYSGDCGSRLCYPGKLNASLVEGKIVLCDRGGNARVEK
GSAVKIAGGAGMILANIAESGEELTADSHLVPATMVGANAGDQIREYIQKSVSPTATISFLGTSIGPSPPSPRVAAFSSR
GPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNIISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV
TTAYDTENSGEPIEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIDVKDYVAFLCAVGYEFPGILVFLQDPTLYNACET
SKLKTSGDLNYPSFSVVFGSTVDVVKYRRVVKNVGTNVDAVYEVGVKSPANVEIDVSPRKLAFSKGEGELEYEVTFRSVV
LGGGVGSVPGHEFGSIEWTDGEHVVKSPVAVQWGQGSVQSF*

DNA
ATGGCTAAGCTCTCTCTCTCCTCTGTCTTCTTCGTTTTCCCTCTCTTCCTCTGTTCCTTCTCGTCGTTATCTTCTTGGGA
TGGCTTAGAATCTTACATCGTTCATGTGCAGAGTTCTCATAAGCCTTCTCTCTTCTCCTCCCACGACCATTGGCACAACT
CTCTCCTCCGCTCTCTACCGTCCTCTCCACAACCCGCGACGCTCCTATACTCTTACTCACGCGCCGTTCAAGGCTTCTCT
GCTCGTCTCTCACCTACACAGACCGCCGATCTTCGCCGTCATCCTTCCGTTATCTCCGTTATACCAGATCAAGCGCGTGA
GATTCACACCACTCATACACCTGCCTTCCTCGGTTTCTCAGATAACTCCGGTCTCTGGAGCAACTCCAATTACGGCGAAG
ACGTGATCGTCGGCGTTCTCGACACCGGAATCTGGCCGGAGCATCCGAGTTTCTCCGATTCAGGTCTCGATCCCGTTCCA
TCTACGTGGAAAGGCGCGTGCGAGACAGGACCTGACTTTCCCGCTTCGTCTTGCAACCGGAAGCTCATCGGAGCTCGAGC
GTTCTACAAGGGATACTTGACGCATCGTAATGGGACGGTGAGGGCAGCGAAGGAATCGCGATCGCCGCGGGATACGGAAG
GTCATGGCACGCACACGGCATCTACTGCAGCAGGATCGGTGGTGGCGAACGCGAGCTTGTATCAATACGCGCGAGGAGTG
GCGCGTGGGATGGCGTCGAAGGCGAGAATCGCAGTTATAAAATCTGTTGGACAGGCCGTTGCTGACGGTGTTCACGTGAT
CTCTCTTTCTGTTGGTGCTAACGGTTACGCTCCGGAGTACCATATGGACTCAATCGCGATCGGAGCGTTTGGAGCCACGC
GTCATGGTATCGTCGTTTCCTGCTCCGCTGGAAACTCTGGTCCTGGTCCTCAAACCGCTACTAACATCGCTCCTTGGATC
TTAACCGTCGGTGCGTCAACGACCGATAGAGAGTTCTCCGCAAACGCAATCACCGGCGACGGGAAAGTCTTCACCGGAAC
GTCGCTCTACGCCGGCGAGCCTCTACCTGATTCTCAGCTTTCTCTTGTATATTCCGGCGACTGCGGAAGCAGATTGTGCT
ACCCCGGGAAGCTGAACGCGTCCTTGGTGGAAGGGAAGATCGTTCTCTGTGACAGAGGAGGTAACGCCAGAGTTGAGAAA
GGAAGCGCCGTCAAGATCGCCGGCGGAGCAGGGATGATTCTCGCGAACATAGCTGAAAGCGGCGAAGAGCTCACCGCCGA
TTCGCATCTCGTCCCGGCTACGATGGTCGGAGCTAACGCTGGAGATCAAATCCGTGAGTACATTCAAAAGTCTGTCTCTC
CCACCGCAACAATCAGCTTCTTAGGCACTTCGATCGGACCTTCTCCTCCTTCTCCCAGAGTCGCGGCCTTCTCCAGCCGT
GGACCAAATCATATAACTCCGGTTATCCTTAAACCGGATGTGATTGCGCCAGGAGTTAATATATTAGCCGGTTGGACCGG
AATGGTTGGTCCAACCGATTTGGATATCGATCCGAGACGGGTCCAATTCAATATAATCTCCGGTACATCGATGTCGTGCC
CACACGTGAGCGGACTCGCCGCTCTCCTCCGTAAAGCTCATCCCGATTGGTCACCGGCGGCGATCAAATCCGCCCTCGTT
ACAACCGCTTACGATACAGAAAACTCCGGCGAACCAATCGAGGATCTCGCCACCGGTAAGCCGTCGAACTCATTCATCCA
CGGAGCTGGACACGTGGATCCGAACAAGGCGTTGAACCCTGGGTTGGTTTACGACATCGACGTCAAAGACTACGTGGCCT
TCCTCTGCGCCGTGGGATACGAGTTTCCGGGGATTCTAGTTTTCCTTCAAGATCCAACTCTTTACAACGCCTGCGAGACG
AGCAAGCTAAAAACCTCCGGCGATCTCAATTACCCGTCGTTCTCCGTCGTTTTCGGATCGACCGTCGATGTTGTGAAGTA
CAGAAGGGTTGTTAAGAACGTTGGAACCAACGTTGACGCGGTGTACGAAGTCGGGGTTAAGTCTCCGGCGAATGTGGAGA
TCGATGTGTCTCCGAGGAAGCTTGCGTTTAGCAAGGGGGAAGGCGAGTTGGAATACGAAGTGACGTTTCGGAGCGTTGTG
CTCGGCGGCGGAGTTGGATCCGTACCGGGTCATGAATTCGGGTCGATCGAATGGACAGACGGTGAACACGTCGTGAAGAG
CCCGGTGGCTGTTCAGTGGGGTCAGGGATCAGTTCAGTCATTCTGA