Details for Kale Locus Bo5g131740

Position : C5 ( 5`- 40620196 .. 40622124 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131740

Protein [Map View]
MNAVNFLYTKNPKFRGIFNGLCALILFFFFFDRSEILKNPLLKKASFVSKGKLNTNGFTQFTLVRRHMIEEDVSKFGNDT
LSSTSTVLCSGLHNHIGYADQCDFLKANPSCSPDGFFDYLSFFYCSCRDFKILGYMILGVWLVALFYLLGNTAADYFCCS
LEKLSKLLRLPPTLAGVTLLPLGNGAPDVFASIAAFVGSDKGEVGLNSVLGGAVFVTSVVVGIVSLCVADMEVKLDKKCF
IRDLSFFLFSLVSLMVILMVGEVTVRIAVAFVSIYVVYAFLVAANVILRKHAKRFKIEAITPLLPMQGSVFSPSVGEDVP
IHSPLIESDSEDGPPRLLNSLPQWMWASNVAIYSNHFARGSSVQDDDRPPWGWIEDGAEAESSFCNKFTSLLEIPLTVPR
KLTIPSVEEDTWSKTYAVASVTLAPLLLASLWSSQDNVSPQACGVAYFISLAIGSTLGFLAYKNTEPDHPPRRFLIPWVL
GGFIMSIVWFYMIANELVALLVTFGEIYGINPSILALTVLAWGNSMGDLVSNIALSMNGGDGVQIALSGCYAGPMFNTLV
GLGMSMLLGAWSKSPDTYMVPEDKSLFYTLGFLVLGLVWAMVMLPRNDMQPNKTLGIGLIALYLIFVTFRLSCAMGFIPW
AA*

DNA
ATGAACGCTGTGAATTTTCTTTACACGAAAAACCCTAAGTTTCGAGGGATTTTCAACGGCCTCTGCGCTTTGATTCTATT
CTTCTTCTTCTTCGATCGGAGCGAAATTCTCAAGAACCCTTTGTTAAAGAAAGCGTCTTTCGTCTCCAAAGGTAAACTCA
ACACCAATGGTTTCACCCAATTCACGCTAGTTCGTCGACACATGATCGAAGAAGATGTTTCGAAGTTCGGTAATGACACC
TTGAGCAGCACTAGTACTGTCTTATGCTCGGGTTTACATAACCACATCGGTTACGCTGATCAATGTGACTTCTTAAAAGC
GAATCCGAGCTGCTCACCTGATGGGTTCTTTGACTACCTCAGCTTCTTTTACTGCTCCTGCAGAGACTTCAAGATCTTGG
GTTACATGATCCTCGGCGTTTGGCTCGTTGCCTTGTTTTATCTCTTGGGTAACACCGCTGCTGATTACTTTTGTTGCTCC
TTGGAGAAGCTCTCTAAGCTTCTGAGGCTGCCTCCTACTCTTGCTGGCGTTACTCTGCTTCCTCTCGGGAACGGAGCGCC
GGATGTGTTTGCGAGTATAGCTGCTTTTGTCGGTTCGGATAAAGGTGAAGTTGGTCTTAACAGCGTCCTTGGCGGTGCTG
TTTTTGTCACTTCCGTTGTTGTTGGGATTGTTTCGCTTTGTGTTGCGGATATGGAAGTGAAGCTTGATAAGAAGTGCTTT
ATCAGAGACTTGAGTTTCTTCCTTTTCTCGCTTGTGTCTCTGATGGTGATTCTGATGGTTGGGGAGGTGACGGTGCGGAT
TGCTGTTGCGTTTGTTTCGATATATGTTGTTTATGCTTTTCTGGTGGCGGCGAATGTGATTCTGAGAAAGCATGCTAAGA
GGTTTAAGATAGAGGCGATCACTCCTTTGTTACCTATGCAAGGGAGCGTTTTTTCGCCGAGTGTTGGAGAGGATGTTCCG
ATTCATAGCCCGTTGATTGAGAGTGACTCTGAGGATGGTCCGCCTCGGCTGCTGAACTCTCTTCCTCAGTGGATGTGGGC
TTCAAACGTGGCTATCTATTCAAACCATTTCGCCAGAGGTAGTAGCGTGCAAGATGATGACAGGCCACCTTGGGGATGGA
TTGAAGACGGTGCGGAAGCTGAGAGCTCCTTCTGTAATAAATTCACTTCGTTGTTGGAGATCCCACTGACGGTTCCGAGG
AAGTTAACAATTCCATCTGTGGAGGAAGATACATGGTCGAAGACATACGCTGTGGCCAGCGTTACGTTAGCGCCTCTGCT
TCTGGCGTCTCTATGGAGTAGCCAAGACAATGTGAGTCCACAAGCTTGTGGTGTGGCTTACTTTATCAGCCTAGCTATTG
GCTCTACTCTTGGCTTTTTGGCTTACAAAAACACAGAACCGGATCACCCGCCTCGGAGATTCTTGATCCCTTGGGTTCTC
GGTGGGTTTATCATGAGCATCGTATGGTTCTACATGATTGCAAACGAGCTCGTTGCGCTTCTAGTAACATTTGGTGAGAT
CTACGGAATCAACCCGTCGATACTTGCGTTAACAGTACTCGCTTGGGGAAACTCAATGGGCGACTTAGTATCAAACATTG
CATTGTCGATGAACGGTGGGGATGGTGTACAGATCGCTCTATCGGGATGTTACGCAGGTCCAATGTTCAACACACTGGTC
GGACTCGGTATGTCAATGCTTCTTGGCGCATGGTCTAAAAGTCCTGACACATACATGGTCCCGGAAGACAAAAGCTTGTT
CTACACACTTGGGTTTCTAGTACTCGGTTTGGTTTGGGCTATGGTGATGCTTCCTCGCAACGACATGCAACCTAACAAAA
CCTTAGGTATTGGACTCATTGCTCTGTATCTGATATTCGTCACTTTCAGGCTCAGCTGCGCCATGGGATTTATACCATGG
GCTGCTTAG