Details for Kale Locus Bo5g131730

Position : C5 ( 5`- 40613360 .. 40614404 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131730

Protein [Map View]
MSWAGPEDIYLSTSLASYLDRKILVLLRDGRKLMGTLRSFDQFANAVLEGACERVIVGEQYCDIPLGLYVIRGENVVLIG
DLDTEREELPPNMIRVSETEIKRAQKVEREASELRGTMRKRMEFLDFD*

DNA
ATGTCGTGGGCTGGTCCTGAAGATATTTACCTTTCAACTTCACTCGCTAGTTATCTCGATAGAAAGATACTTGTGCTCCT
TAGAGATGGTAGAAAGCTAATGGGAACCCTCCGTTCATTTGACCAATTCGCCAATGCGGTTCTAGAAGGTGCTTGCGAGA
GGGTGATTGTTGGTGAGCAATACTGTGATATTCCTTTAGGCCTCTATGTAATCCGTGGAGAGAATGTTGTTCTGATTGGT
GACCTGGACACGGAGAGAGAGGAGCTTCCTCCAAATATGATTCGTGTCTCAGAGACTGAGATTAAAAGGGCGCAAAAGGT
GGAGAGGGAAGCGAGTGAGCTGAGAGGAACAATGAGGAAGAGAATGGAGTTTCTTGACTTCGATTAA