Details for Kale Locus Bo5g131710

Position : C5 ( 5`- 40607762 .. 40609386 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131710

Protein [Map View]
MSAIIRCCSSFSDTSRGGPPSLGRSRVPETGKLAKSIGYSLVRTPRAYHPIFSKIKPLSTKPKEHESKGILQTPFGSVET
FEMWQGIGRLKLPGMAVLLTNSLLMGTPLEALAADMCEPESSIFSMPFLLLVALVGATVGGLLARQRKGELQRLNEQLRQ
INAALRRQAKIESYAPGLSYAPAGARIPGSEIIMEPKKHELISKLKTGKTFLRNQEPDKAFEEFKTALELAQNLRDPIEE
KKAARGLGASLQRQGKYREAIQYHNLVLAISKREGEDSGSTEAYGAIADCYTELGDLEKAGKYYDTYIARLETD*

DNA
ATGTCGGCGATTATCCGGTGCTGCTCCTCCTTTTCCGATACTTCCCGCGGCGGACCTCCGTCTCTGGGAAGATCTCGAGT
TCCAGAGACGGGAAAGTTAGCTAAATCTATTGGCTACTCCTTAGTCAGAACACCTAGGGCTTATCATCCTATATTCTCCA
AGATTAAACCTTTGTCTACCAAGCCCAAGGAGCATGAAAGTAAAGGAATCTTACAAACACCATTTGGCAGCGTGGAAACT
TTTGAGATGTGGCAGGGAATTGGGAGGCTCAAATTACCGGGGATGGCAGTGCTTTTGACAAACTCCCTTCTGATGGGTAC
ACCACTTGAAGCTTTGGCTGCTGACATGTGTGAGCCTGAGAGCTCCATCTTCAGCATGCCATTTTTGCTGCTTGTTGCTC
TTGTTGGAGCCACTGTTGGAGGGTTGCTTGCTCGGCAGAGGAAAGGGGAGTTACAGAGGTTAAACGAACAACTACGGCAG
ATCAACGCAGCTCTCAGGAGACAAGCGAAAATCGAGTCTTATGCACCAGGCTTGAGTTACGCACCAGCAGGAGCTAGAAT
CCCAGGGAGTGAGATCATCATGGAGCCAAAGAAACATGAGCTGATCTCCAAGTTGAAAACAGGAAAGACCTTTCTGAGGA
ATCAAGAGCCAGATAAGGCTTTTGAAGAGTTCAAGACAGCTTTGGAACTTGCACAGAATCTCAGAGACCCCATCGAAGAG
AAGAAGGCTGCCAGAGGCTTAGGCGCTTCGCTGCAGCGTCAAGGGAAGTACAGAGAAGCCATACAGTATCACAACTTGGT
TTTAGCCATCTCAAAGAGGGAAGGAGAAGATTCTGGAAGCACTGAAGCGTATGGAGCTATCGCAGATTGTTACACTGAGC
TGGGGGATCTCGAGAAAGCCGGGAAGTACTATGACACCTACATTGCTCGGTTAGAGACAGACTGA