Details for Kale Locus Bo5g131700

Position : C5 ( 5`- 40599793 .. 40607360 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131700

Protein [Map View]
MEMDMDTSPSYFDPEVLTVRDQFRRYGKRHSTSPHEEFSSPNVSENRLLYDGHSIHSPTNTALLLENIKEEVDNFHTDLY
QGTPAVPLSASKRESAGILDGDDEASFRRVESQSLKACKIENDELAESGDTTFALFASLFDSALQGLMPIPDLILRLEES
CRDVSQSIRYGSDIRHRVVEDKLMRQKAQLLLGEAASWSLLWNLYGKATEEVPEELIMSPSTSHLEACQFVVNDHTAQLC
LRIVLWLEELASKSLDLERKVRGSHVGTYLPNAGVWHHTQRYLKKTGSTADTVRHLDFDAPTREHARLLPDDNKQDESLL
EDVWILIRAGRIEEACDLCRSAGQPWRAATLCPFSGMDMFPSVEALIKNGKNRTLQAIELESGFGNQLRLWKWASYCASE
KITEQDGGKHEVAVFANQCSNLNRILPVCTDWEAACWAMAKSWLDVQVDLELAQSKPGLAERFRNRLDESPDTMQNGCQG
PEDWPLHVLNQQPRDLSALLQKLHSGEMVHEAVVRGCKEQHRQIQMNLMKGDISHLLDLIWSWIAPLEDDQSNFRPHGDP
QMIKFGAHVVLVLRYMLADEIKDREKLSNVGDLILHMYSMFLFSKQHEELVGIYASQLAGHRCIELFVHMMELRMHSSVH
VKYKIFLSAMEYLPFSHVDDSQGNFEEIVDRVLSRSREIKLAKYDPSVDVAEQHRQQSLQKAIAIQWLCFTPPSTIKDVK
DVTSKLLLRSLMHSNILFREFALIAMWRVPATPVGAHTLLSFLAEPLKQLSENPDTLVDYVSDNLQEFQDWNEYYSCDAK
YRNWLKFQVENAEVTDLSEEENQKAIVAAKETLDSSLLLLLRKDNPWLTFLEDNVFESEEYMFLELHATAMLCLPSGECL
RPDATICAALMSALYASVTEQVVLDRQLMVNVSISSRDSYCIEVVLRCLATEGDGLGPHNANDGGILSAVAAAGFKGELT
RFQAGVTMDISRLDAWYSSKEGSLETPATYIVRGLCRRCCLPELVLRSMQVSVCLMESGNPPEDHDELIELVASDETGFL
SLFSQLQLQEFMLFEREYRLSQLELQEDLSSS*

DNA
ATGGAGATGGATATGGACACTTCTCCTAGCTACTTCGACCCTGAGGTCCTCACTGTTAGGGATCAGTTCCGTCGTTATGG
GAAGAGACACTCTACATCGCCACATGAGGAATTCTCGAGTCCCAATGTCAGCGAGAACAGATTACTGTATGATGGGCATT
CCATCCACAGTCCAACAAACACTGCCTTGCTTCTTGAAAACATTAAAGAAGAGGTTGACAACTTTCACACCGATCTTTAC
CAAGGAACACCTGCAGTTCCGCTATCTGCTTCCAAGAGGGAAAGTGCTGGAATTCTGGATGGTGATGATGAGGCTTCGTT
TCGACGAGTTGAAAGTCAGTCACTGAAGGCTTGCAAGATTGAGAATGATGAGTTGGCCGAGAGTGGAGATACGACCTTTG
CTCTCTTTGCTTCCCTGTTTGATTCTGCTCTTCAAGGACTCATGCCCATTCCAGATCTTATATTAAGACTTGAGGAGTCA
TGCAGGGATGTTTCACAATCAATTAGGTATGGATCAGATATAAGACATCGGGTTGTAGAGGATAAACTTATGAGACAGAA
GGCTCAGCTTTTGCTTGGTGAGGCTGCATCCTGGTCACTTCTATGGAACTTATATGGAAAAGCTACTGAAGAAGTTCCAG
AGGAATTGATTATGTCACCATCAACATCTCATTTGGAGGCTTGTCAGTTTGTTGTAAACGACCATACAGCTCAGCTATGC
CTTCGGATAGTCCTGTGGCTGGAAGAACTAGCTTCCAAATCACTTGATTTGGAAAGGAAGGTGCGGGGATCTCATGTGGG
TACCTATCTTCCTAACGCTGGAGTGTGGCATCACACACAAAGGTACCTCAAAAAAACTGGCTCTACCGCTGACACTGTAC
GCCATTTAGACTTTGATGCTCCAACTCGTGAACACGCTCGTCTTCTTCCTGATGACAATAAACAAGATGAATCTCTTCTT
GAGGATGTTTGGATTTTGATAAGGGCTGGGAGAATAGAGGAGGCATGTGATCTCTGCAGGTCCGCTGGGCAGCCATGGAG
AGCTGCAACGTTATGCCCTTTTTCTGGAATGGACATGTTTCCTTCTGTCGAGGCACTGATAAAGAATGGGAAAAATAGGA
CTCTCCAAGCTATCGAACTGGAAAGTGGCTTTGGCAATCAGCTGCGTCTTTGGAAATGGGCTTCGTACTGCGCATCAGAG
AAAATCACAGAGCAGGATGGCGGCAAACATGAAGTTGCTGTTTTTGCAAACCAATGTAGCAACCTGAACCGCATCTTACC
AGTTTGTACTGATTGGGAGGCAGCTTGCTGGGCGATGGCAAAATCATGGCTTGATGTTCAAGTTGATCTAGAACTCGCTC
AATCGAAGCCAGGCTTGGCAGAAAGGTTTAGAAACCGTCTTGATGAAAGCCCTGATACTATGCAAAATGGTTGTCAGGGG
CCCGAAGATTGGCCGCTCCATGTTCTAAACCAACAACCCCGTGATCTTTCTGCTCTTCTTCAGAAACTCCATTCAGGGGA
AATGGTACACGAAGCTGTTGTCAGGGGATGCAAAGAGCAGCACCGGCAAATACAGATGAACCTTATGAAGGGGGATATCT
CACATCTTCTTGATTTAATATGGTCATGGATCGCGCCCTTGGAAGATGATCAAAGCAATTTTAGGCCCCATGGCGATCCT
CAGATGATAAAGTTCGGTGCCCACGTGGTGCTTGTTCTTAGGTATATGCTTGCTGATGAAATCAAGGACAGGGAGAAGCT
CAGTAATGTTGGCGATCTTATTCTTCATATGTACTCGATGTTCTTATTTTCAAAACAACATGAAGAACTAGTAGGAATAT
ATGCATCTCAGCTTGCTGGTCACCGCTGCATTGAACTTTTTGTACACATGATGGAGCTAAGGATGCATAGCAGCGTACAT
GTGAAGTACAAAATCTTCCTCTCCGCTATGGAATACTTGCCATTCTCTCACGTGGATGACTCGCAAGGAAATTTTGAGGA
AATAGTTGACAGGGTTTTGTCGAGATCCCGAGAAATCAAGCTTGCAAAATATGATCCCTCAGTTGATGTTGCAGAGCAGC
ATCGTCAACAGAGTCTACAAAAAGCCATAGCCATTCAGTGGCTCTGTTTTACACCTCCATCTACTATAAAGGATGTCAAG
GATGTCACTTCCAAACTACTCCTGCGATCTTTGATGCACAGCAACATACTTTTCCGAGAGTTTGCTTTAATTGCCATGTG
GAGGGTGCCTGCAACTCCTGTGGGTGCACACACACTTCTTAGTTTCCTTGCTGAACCTCTGAAGCAACTCTCAGAAAATC
CAGACACCCTCGTGGATTATGTTTCCGATAATTTGCAAGAGTTCCAAGACTGGAATGAATATTATTCCTGTGACGCAAAA
TATCGCAACTGGCTCAAATTCCAAGTAGAGAATGCTGAAGTCACTGATCTATCAGAAGAGGAGAATCAGAAAGCTATAGT
AGCAGCCAAAGAGACTCTGGATTCTTCTTTGTTACTGCTCCTCAGAAAAGACAATCCCTGGCTGACATTTCTCGAAGACA
ATGTATTCGAATCAGAAGAATATATGTTCCTTGAGTTGCATGCAACTGCTATGCTCTGTTTGCCTTCTGGTGAATGTTTG
CGCCCAGATGCCACTATTTGTGCGGCATTGATGAGTGCGCTTTACGCCTCTGTCACTGAGCAAGTTGTTTTAGACCGTCA
GTTAATGGTAAATGTATCCATTTCATCAAGGGACAGCTACTGCATCGAGGTTGTGCTCCGGTGTTTAGCAACTGAAGGTG
ATGGACTTGGGCCACATAATGCCAATGACGGGGGTATTTTAAGTGCAGTTGCGGCAGCCGGATTTAAAGGTGAGCTTACC
CGGTTCCAGGCAGGTGTTACAATGGATATATCCCGCCTAGACGCTTGGTATTCAAGCAAAGAGGGCTCGCTTGAAACACC
TGCAACTTATATTGTTCGCGGTCTCTGTAGGAGATGCTGTCTTCCAGAGCTCGTTCTTCGATCTATGCAGGTTTCTGTTT
GTCTAATGGAATCGGGTAATCCACCTGAAGATCACGATGAACTGATTGAGCTCGTTGCTTCTGATGAAACTGGTTTTCTG
TCTTTATTCAGTCAGCTACAGTTACAGGAGTTTATGTTGTTTGAGAGAGAGTATCGTCTGTCCCAGTTGGAGCTCCAGGA
GGACCTTTCATCATCTTGA