Details for Kale Locus Bo5g131680

Position : C5 ( 5`- 40592809 .. 40594415 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131680

Protein [Map View]
MNNGEGWSSGGRRGPRGRSNSKETWQIVNRPKSESPVTVDRSLDESSGNRSSRGSRGRGRCRTVQVYVEKSSQVSNVGKA
AQEEVKSQEDGLGSTKQPDEGAAFKCSGDNSDLLQPSASPVSRECEGRMSFGLANRMEDVSLCGQVSMSSTSDKKVEDRD
SAHKSGDVGNAWNESNTRVFDICLEKKVFCLKSSILELNREKRRATKGYPGIVIRPGMVLLKNYLSINDQVMIVNKCREL
GLGEGGFYQPGYGDGALLHLKMMCLGRNWDPQTSRYGDTRPHDGSVPPKIPFEFNQFVQKAIQDSQSLVATSSKKTKGED
EIPCMSPDICIANFYTSTGRLGLHKDKDESANSIQKGLPVVSFSIGDSAEFVYGDQRDYDKAEMEVLESGDVLLFGGKSR
NIFHGVRSILKDTAPKVLVQETNLRPGRLNLTFRQY*

DNA
ATGAATAACGGAGAAGGTTGGAGTTCCGGTGGCCGTCGGGGTCCTAGGGGCCGCTCTAACTCCAAGGAGACTTGGCAAAT
AGTAAACCGTCCAAAAAGCGAAAGTCCGGTTACGGTTGATAGGTCTTTGGATGAATCTTCTGGTAATAGGAGCAGTAGGG
GGTCTCGAGGGCGAGGAAGATGTAGAACTGTGCAAGTGTACGTTGAGAAGTCGTCCCAAGTTTCCAATGTGGGAAAGGCA
GCTCAAGAAGAAGTAAAGTCCCAAGAGGATGGCTTAGGTTCTACCAAGCAACCTGATGAAGGTGCAGCTTTCAAGTGTTC
TGGAGATAACAGTGATCTTTTGCAACCATCTGCTTCACCTGTCTCTAGAGAATGTGAGGGTAGAATGTCTTTTGGTCTAG
CGAATAGGATGGAAGATGTTTCGCTCTGTGGCCAGGTGTCTATGTCTTCTACAAGTGATAAGAAGGTTGAGGATCGTGAT
AGTGCTCATAAGTCTGGTGATGTAGGGAACGCTTGGAATGAAAGCAACACTAGAGTTTTTGATATCTGCCTCGAGAAGAA
GGTGTTTTGTCTAAAATCCTCCATCTTGGAACTTAACAGAGAAAAGAGGAGAGCAACCAAGGGGTACCCTGGGATTGTTA
TTAGACCTGGGATGGTCCTTCTCAAGAACTACTTGTCAATCAACGATCAGGTGATGATTGTGAACAAATGCCGGGAGCTC
GGTTTGGGTGAAGGAGGCTTCTATCAACCAGGTTATGGAGATGGAGCATTATTGCATTTGAAGATGATGTGCCTGGGGAG
AAACTGGGACCCTCAAACATCTCGATATGGAGATACTCGACCACATGACGGTTCTGTCCCACCTAAAATTCCTTTTGAGT
TCAATCAGTTTGTTCAGAAAGCAATCCAAGATTCACAGTCCCTTGTCGCTACAAGCTCAAAGAAGACGAAAGGAGAAGAT
GAGATACCATGTATGTCACCAGACATCTGTATTGCTAACTTCTACACATCCACTGGGAGACTTGGTCTACATAAGGACAA
AGATGAGAGTGCAAATTCCATTCAGAAGGGCTTACCTGTTGTATCATTTTCAATTGGAGATTCAGCCGAGTTCGTGTATG
GTGATCAGAGGGATTATGACAAGGCAGAGATGGAAGTCTTGGAATCTGGAGATGTTCTACTCTTTGGTGGCAAGTCCAGA
AATATCTTTCATGGCGTCAGATCAATTCTCAAAGATACTGCTCCTAAGGTTCTTGTCCAGGAAACAAACCTCCGACCAGG
TCGTCTGAATTTGACTTTTAGGCAGTATTAA