Details for Kale Locus Bo5g131670

Position : C5 ( 5`- 40590832 .. 40592598 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131670

Protein [Map View]
MASLTPRVLIKLLQTMNTNIKVRGEYRSVLLQVISIVPALAGSELWPNQGFFIKVSDSSHSTYVSLRNEDNELILNNKLG
LGQFFYVDKLEPGTPVPVMVGVRPISGRHPFVGNPKDLMQMLVPTETTTTPPMQEDNHKQKKDGARSNAVESLRRRQDFV
IKEEKTGVASRYMQGVSNARVSGSDSSSGGSNNESEAGSVKASKRVGGLAKGKQREHKDQVRQACPPQSQSRPATAPTKA
EQKINHINRKSNSSEDASWRSLPANLTKMGKGMLRRRNIAVLLAAEAQRDALAASHLLKCINMFADLSSSASPKNPHTSL
RSFFNLQSLLDQAQLTAAPSKEKPLQLLNIHPVCTEPEKLSKRASLASSRATTKSSKTLTEAEKLEWVTGNGTKEIKAMR
DTMTQETRSWFMRFLEEAIDTGFHASVQVKKGKTKGSRAEEPDNHIAETLSQLKQANEWLDKVKSDHHSSDDDSLLENIE
RLKKKIYSCLLLYVDSAASAIAVSTSS*

DNA
ATGGCTTCTCTTACGCCTAGAGTGTTGATCAAGCTTCTCCAGACAATGAACACAAACATCAAAGTCCGAGGAGAATACCG
GTCTGTTCTTCTGCAGGTGATCAGCATTGTCCCTGCTTTAGCCGGCTCGGAGCTTTGGCCCAACCAAGGCTTCTTCATCA
AAGTCTCGGATTCTTCTCACTCCACATACGTCTCGTTGAGAAACGAAGACAACGAACTCATCTTGAACAACAAACTGGGA
CTGGGACAGTTCTTCTACGTCGATAAGCTCGAACCTGGGACGCCTGTTCCTGTGATGGTGGGAGTTAGACCCATCTCTGG
ACGCCATCCTTTTGTAGGAAACCCCAAAGATTTGATGCAGATGTTGGTTCCCACCGAGACAACAACAACACCACCTATGC
AAGAAGATAATCACAAACAGAAGAAGGATGGTGCGAGATCAAACGCGGTGGAGAGTCTAAGAAGGCGTCAAGATTTTGTA
ATCAAGGAGGAGAAAACAGGCGTGGCGTCAAGATATATGCAAGGCGTTTCAAACGCAAGGGTGAGTGGATCAGACTCGAG
TAGTGGTGGTAGCAACAATGAGAGCGAGGCTGGATCAGTGAAGGCGAGTAAGAGAGTTGGTGGTTTGGCTAAGGGCAAGC
AAAGGGAGCATAAAGATCAGGTACGTCAAGCTTGTCCTCCACAGTCTCAGTCTCGGCCTGCGACAGCTCCAACGAAGGCA
GAACAAAAGATAAATCATATAAACAGGAAGAGTAATTCTTCTGAGGATGCATCATGGAGATCTCTGCCTGCTAATCTAAC
AAAAATGGGTAAAGGAATGCTGAGGAGGAGAAATATTGCTGTTCTGCTTGCTGCAGAAGCACAAAGAGATGCATTGGCTG
CTTCACATCTTCTCAAGTGTATCAATATGTTTGCTGATCTCAGCTCAAGTGCTTCACCAAAGAATCCACATACCTCTCTC
AGAAGCTTCTTCAACCTCCAGAGTCTACTTGACCAAGCACAGCTCACAGCTGCACCATCGAAAGAGAAACCACTCCAGCT
TTTGAATATTCATCCAGTATGTACTGAACCTGAGAAGCTGAGCAAAAGAGCGAGTCTAGCATCAAGCAGAGCCACAACAA
AGTCTTCAAAAACTCTAACAGAAGCCGAGAAGCTAGAGTGGGTCACAGGGAACGGTACAAAAGAGATAAAAGCAATGAGA
GACACTATGACACAAGAAACAAGAAGCTGGTTTATGAGATTCTTGGAAGAGGCAATAGATACTGGGTTTCATGCTAGTGT
CCAAGTTAAGAAAGGTAAAACCAAAGGATCACGAGCAGAGGAACCAGATAATCACATTGCCGAGACTTTATCTCAACTTA
AGCAAGCAAACGAGTGGCTGGACAAAGTTAAAAGTGATCACCACTCTAGTGATGATGATTCTTTGTTAGAGAACATAGAA
CGGTTGAAGAAGAAAATATACTCTTGCTTGCTACTTTATGTTGATTCAGCTGCATCAGCTATCGCAGTATCAACAAGCTC
GTGA