Details for Kale Locus Bo5g131660

Position : C5 ( 5`- 40584670 .. 40590128 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131660

Protein [Map View]
MRPSIPLDYALFQLSPKRSRCELFVSTAGYTEKIASGLVKPFVAHLKVAEEQVAREALSIRLQVESSKNAGTWFTKATLE
RFVRFVSTPEVLELVSALDEEMSQLEAARKIYGEGTGDQRSGAKDGTETTPAADVTKKELLRAIDLRLAAVRQDLETACN
RASAAGFNPITVPELTQFADRFGASRLNDACTKFIAVCQRRPELMSSWRLFNQEQEAIRSSWESDMSIDDPTEDPSKNLG
SGMEEKSVTATRYSQQEAKLMPQSSHGEKDEEEEKTPVQNEPLASQTRQLTRRLSVQERINLFENKQKENSGGKTAVVVK
PTDLKRLSSDLSSSAGVEKAVVRRWSGASDMSIDLGNDRKDVAGDSPSSSSVSKDGSGGISSKQSVGCNKREHNGLSHTE
NPHKNEDECSSNSTGDMGTDKVESHKSSSPFLRKDKEVDLKVPLDYSGNANIDDESNNKIGDFESDKQDQIQFRDPRSHS
LSTLHQLSGTESSLTSVRSNGGTAESPRRESSATRQSPPAEDRQGKTQLYGGTEQMRRPHGRRAETGSADVNKKPPSAIN
ISVSDISESDTLNQMSPAEQVQRARASKGSQELNDELKVKANELEKLFAEHMLRVPGDQSSSVRRGKPVKPSEQAVTSQL
RRPVAEDLITSSNDEDKFKTPPTVKAVANSDYGDTTRQKLPEISFSDSSRGKFYEEYMQKRDAKLKEDWSSRRTEKEAKL
KVMQDVLDRSNAEMKTKFSQSTARRDSDARRAEKLVYFNSRLSARQDQHPISSFQSEEEEDVSRSTQNTKLQQNKNTSRT
ITTSASRSAAKVSTPSSARRRGQDKLLAQSVPNFAEFKKEGMKQPSSGVGRNGVRSQARSSVRPKAVITEEEKLRRPTNF
RKVAAEAAAPEDDAVSVPLNLEQEQSGRKASEGSDASDEMEKEEVEDVLGDDTEAEAFTDAENEKSRLSQDFEDGESIAS
QLDPGSNAELPIASRHHQTIGSFLDARVKQQQYQNEASELDASVDSPVDSPTFWSLSHTENDTTQMRKKWGAAENKQDVT
KGLKRLLNFGRKNRAAENLADWISATTSEGDDDTEDGKDLAYRSSEDLRKSRFLQTQPSDDSFNESELFNEQARTTSAPL
SFKLKEDQMSGASVKAPRSFFSLSNFRSKGK*

DNA
ATGAGACCATCAATACCTCTTGACTATGCTCTCTTCCAACTCTCCCCAAAGCGGTCAAGATGTGAATTGTTTGTCTCTAC
TGCGGGGTATACTGAGAAGATTGCTTCTGGACTGGTCAAACCGTTTGTTGCTCATTTGAAAGTCGCTGAAGAGCAGGTGG
CCAGGGAAGCTCTGTCTATAAGGCTACAAGTTGAGAGCAGCAAAAATGCTGGAACTTGGTTTACTAAAGCGACGCTCGAG
AGGTTTGTACGCTTTGTTAGTACCCCAGAGGTTCTGGAATTGGTTAGCGCTTTGGATGAGGAAATGTCTCAGTTAGAGGC
TGCCCGTAAAATATACGGCGAGGGGACTGGTGACCAGCGATCTGGTGCAAAAGATGGCACAGAAACTACACCAGCGGCTG
ATGTGACAAAGAAGGAGCTACTGAGAGCTATTGATTTACGGCTTGCAGCAGTTAGACAGGACTTGGAAACTGCTTGTAAT
CGTGCTTCTGCTGCTGGTTTTAACCCAATCACTGTCCCCGAACTTACTCAATTTGCTGATCGATTTGGAGCCAGTCGCTT
GAATGACGCATGCACCAAGTTTATAGCAGTTTGCCAGAGAAGGCCAGAGCTTATGAGCTCTTGGAGGTTGTTCAATCAGG
AACAAGAAGCTATACGTTCGTCATGGGAATCTGATATGTCAATTGATGATCCCACTGAAGATCCATCCAAAAACCTGGGA
AGTGGTATGGAAGAGAAAAGTGTAACAGCGACCAGATACTCCCAGCAAGAAGCAAAGCTTATGCCACAGAGTAGTCATGG
TGAAAAGGATGAAGAAGAGGAAAAAACTCCTGTGCAAAACGAGCCATTAGCAAGCCAGACTAGGCAACTAACGAGACGGC
TCAGTGTGCAGGAGAGGATCAACCTATTTGAAAACAAGCAGAAAGAAAACTCTGGAGGGAAAACAGCTGTGGTGGTGAAA
CCCACTGATCTGAAAAGGCTCTCTTCTGATTTATCATCTTCCGCAGGGGTGGAAAAAGCTGTGGTACGGAGATGGAGTGG
TGCTAGTGACATGAGCATTGATTTGGGAAATGATAGGAAGGATGTGGCTGGTGATAGTCCCTCGTCGTCATCAGTGTCCA
AAGATGGAAGTGGTGGTATATCTTCAAAACAATCTGTTGGATGCAATAAAAGAGAGCATAACGGGTTGAGTCATACTGAG
AATCCTCATAAGAATGAAGATGAATGTAGTTCCAACAGTACTGGTGACATGGGAACGGATAAAGTAGAGTCCCATAAATC
AAGCTCTCCTTTCTTACGGAAAGACAAGGAGGTAGACTTGAAGGTGCCTTTGGATTACTCAGGGAATGCAAATATAGATG
ATGAGTCCAATAACAAAATTGGAGATTTTGAATCAGATAAGCAGGATCAAATACAGTTTAGAGATCCTCGGAGTCATTCA
TTGTCTACATTACATCAGTTAAGTGGTACTGAATCTAGTCTCACTAGTGTTCGGAGCAATGGAGGAACTGCGGAGTCTCC
TAGGAGAGAATCTTCAGCTACTAGGCAATCACCACCAGCTGAGGATCGCCAGGGAAAGACACAACTCTATGGAGGTACTG
AACAGATGAGAAGACCACATGGTAGAAGGGCTGAAACTGGTTCTGCCGATGTAAATAAAAAGCCACCTTCAGCCATTAAT
ATTAGTGTGTCAGACATCTCAGAGAGTGATACTTTGAACCAAATGTCCCCGGCAGAGCAAGTTCAAAGGGCCAGAGCCTC
TAAGGGAAGTCAAGAGCTGAATGATGAATTGAAAGTGAAAGCAAACGAGCTTGAAAAGCTATTTGCTGAACACATGCTCC
GTGTCCCCGGGGATCAATCCAGTTCTGTCCGTAGAGGCAAGCCTGTAAAGCCGAGTGAACAAGCTGTGACGTCACAGCTC
AGAAGACCTGTAGCAGAGGATCTAATCACAAGTTCAAATGATGAAGACAAGTTCAAAACTCCACCAACTGTGAAGGCGGT
TGCTAACAGTGACTATGGAGACACCACAAGGCAAAAACTTCCAGAAATCAGCTTTTCAGATAGCTCTAGAGGAAAGTTCT
ATGAGGAGTATATGCAGAAGAGAGACGCCAAGCTGAAGGAAGACTGGAGTTCAAGAAGGACCGAGAAGGAAGCCAAGTTG
AAGGTGATGCAAGATGTACTTGATCGCAGTAACGCTGAGATGAAAACCAAGTTTTCTCAGTCTACTGCAAGACGTGACTC
AGATGCTAGACGTGCAGAGAAGCTTGTGTACTTCAACTCTAGGCTTAGTGCTAGACAGGATCAGCATCCAATTAGCTCAT
TCCAGAGTGAAGAAGAGGAAGATGTTTCCAGGAGCACACAGAATACGAAGCTACAACAAAACAAAAACACTTCTCGAACC
ATTACTACATCAGCTTCACGCTCTGCAGCCAAAGTGTCTACACCCAGTTCCGCTAGGCGGAGAGGACAAGACAAGCTTCT
TGCACAGTCAGTCCCTAACTTCGCCGAGTTCAAGAAGGAAGGCATGAAGCAACCATCCTCAGGAGTTGGGAGAAATGGTG
TCCGCTCACAGGCGAGAAGCTCCGTGAGACCGAAGGCTGTAATAACTGAAGAAGAGAAGCTGAGAAGGCCGACAAACTTC
AGAAAAGTTGCTGCTGAAGCTGCTGCTCCAGAGGATGATGCTGTTTCTGTACCTCTGAATCTTGAGCAAGAGCAAAGCGG
GAGAAAGGCTTCAGAAGGATCCGATGCATCAGACGAAATGGAGAAAGAGGAGGTGGAAGATGTGCTTGGTGATGACACAG
AAGCTGAAGCTTTTACTGACGCAGAAAACGAGAAGTCAAGACTTAGTCAAGACTTTGAAGATGGTGAATCTATAGCTTCT
CAGCTTGACCCTGGTTCAAACGCTGAGTTACCTATAGCTTCTAGGCATCACCAAACCATCGGTTCGTTTCTGGATGCACG
AGTGAAGCAGCAGCAGTATCAAAACGAGGCATCTGAGCTTGATGCTTCAGTGGACTCTCCAGTGGACAGTCCTACTTTCT
GGAGCCTTAGCCACACAGAGAATGATACAACTCAAATGAGAAAGAAATGGGGAGCTGCTGAGAATAAACAAGATGTGACG
AAAGGGTTGAAAAGGCTTTTGAACTTTGGAAGGAAGAACCGTGCGGCTGAGAATTTGGCTGACTGGATATCCGCTACGAC
CTCTGAAGGGGATGATGATACCGAAGATGGAAAAGATCTCGCGTATAGATCATCAGAAGACTTGAGAAAGTCGAGATTCT
TACAAACTCAGCCCTCTGATGATAGCTTCAACGAGAGTGAGCTATTCAATGAACAAGCACGAACCACTAGCGCACCATTG
AGCTTTAAACTGAAGGAGGATCAGATGTCTGGAGCTTCTGTAAAAGCACCAAGGTCATTCTTTTCACTCTCCAATTTTCG
AAGCAAGGGGAAATGA