Details for Kale Locus Bo5g131640

Position : C5 ( 5`- 40571870 .. 40572333 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131640

Protein [Map View]
MHQRAAESTGTITSLLKFYSIMMDAKNNLTCEEPEEIPSPKLSDWLKSSTTPWRSPIRHGSMMMMPYTPLAWRFDSTDFT
LKEDFF*

DNA
ATGCATCAAAGAGCAGCAGAGTCTACTGGAACAATCACTTCTCTGTTGAAATTTTACTCCATCATGATGGATGCTAAGAA
CAATCTGACTTGTGAAGAACCAGAAGAGATACCATCGCCCAAGTTGAGTGATTGGCTGAAGAGCTCAACAACTCCATGGC
GCTCTCCAATCCGGCATGGCTCTATGATGATGATGCCTTACACTCCTCTGGCTTGGCGGTTCGATTCAACTGACTTCACT
CTCAAAGAAGACTTCTTCTGA