Details for Kale Locus Bo5g131620

Position : C5 ( 5`- 40567369 .. 40568762 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g131620

Protein [Map View]
MALNNSEKGNDNFYSLLGLKKECTTTELRTAYKKLALRWHPDRCSSMGNLEFIDESKKKFQGIQEAYSVLSDSNKRFLYD
VGAYNTDDDSDQNGMGDFLSEMAVMMNQSKPGENHSGDSFEHLQDLFHEMLQGEAFASPSPSPSSCYASTFTSSCSFVFD
SNAQQSPFKTTSSMGINDPFAFDSRPHTFSLGVEHQQDFKKGKNNGGRRSRRKNNAQSASHQTSSSNNYGVPTS*

DNA
ATGGCTTTGAACAATAGCGAGAAAGGCAACGATAATTTTTATTCTCTTCTGGGTCTGAAGAAAGAATGTACGACCACGGA
GCTCCGTACTGCATATAAGAAGCTCGCTCTTAGATGGCATCCAGATCGTTGTTCATCAATGGGGAACTTGGAGTTTATAG
ATGAATCAAAGAAGAAGTTTCAGGGCATCCAAGAGGCCTACTCTGTTCTGTCTGACTCCAACAAGAGGTTCCTTTATGAC
GTTGGAGCTTATAATACTGATGATGATTCTGACCAAAACGGAATGGGAGATTTCTTGAGCGAAATGGCGGTAATGATGAA
TCAGTCAAAGCCTGGTGAGAATCATTCAGGAGACAGTTTCGAACATTTACAAGATCTGTTTCATGAGATGCTTCAAGGAG
AAGCATTCGCCTCGCCATCGCCATCGCCATCATCTTGCTATGCTTCGACTTTCACTTCCTCTTGTAGCTTTGTCTTTGAC
TCAAATGCTCAGCAGTCACCGTTTAAGACAACAAGTTCGATGGGGATTAATGATCCTTTCGCATTCGACTCCAGACCTCA
CACCTTCTCTTTAGGGGTGGAACATCAGCAGGACTTCAAGAAGGGGAAGAACAATGGTGGGAGAAGAAGCAGACGGAAGA
ACAATGCTCAATCTGCTTCTCACCAAACGTCGTCGTCCAACAACTATGGAGTTCCCACTTCATAG