Details for Kale Locus Bo5g130540

Position : C5 ( 5`- 40472065 .. 40473994 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130540

Protein [Map View]
MVGKCDLVSVIGAILVLTIFHNPIIVYAGQGVPEVALFTFGDSYYDAGNKAFLSKNKNLPQTLWPYGKSLDDPNGKFSDG
HIVPDFIGDFISIPNGIPPALKPGANLSRGASFAVADASILGAPVESMTLNQQVNKFRSMKSNWTDDYIEKSLFMIYIGT
EDYLNFTKTNPTADASAQQAFVISVTNKLKNDIGLLYSLGASKFMVQLLAPLGCLPIVRQEHGTGNDCYEPLNDLAKQHN
EKIGPMLNQFAKSPGFQFTVFDFYNAILRRTQRPHNYRFYIANSSCCGVGTHTAYGCGMGNVHSKLCEYQRSYLFFDGRH
NTEKAQEELAHLIYGADTNVIQPMTVRELIVFPAGENMLESWEPNLSSVRRRSSTKSTSVYRLLDLIG*

DNA
ATGGTAGGAAAGTGTGATTTGGTGAGTGTTATAGGAGCCATATTGGTACTAACCATCTTCCATAATCCGATCATCGTCTA
CGCCGGCCAGGGTGTTCCGGAAGTAGCGTTGTTTACTTTCGGAGACTCTTATTACGACGCCGGAAACAAAGCGTTTCTAA
GCAAAAATAAAAATCTTCCACAAACCCTATGGCCTTATGGAAAATCCCTTGACGACCCTAACGGGAAGTTTTCCGACGGC
CACATTGTCCCCGATTTTATCGGTGACTTCATATCCATACCGAACGGAATCCCGCCTGCACTTAAACCAGGCGCTAATCT
TTCACGTGGAGCTAGTTTTGCCGTCGCTGATGCTTCTATCCTTGGAGCTCCGGTGGAATCTATGACACTGAATCAACAAG
TGAACAAGTTCAGAAGCATGAAATCAAATTGGACCGACGACTACATCGAGAAATCACTGTTTATGATATACATCGGTACA
GAAGATTATTTGAACTTCACCAAGACCAATCCCACTGCAGACGCTTCTGCTCAGCAAGCTTTTGTCATTTCCGTCACGAA
CAAATTAAAGAACGACATCGGCTTGTTATACTCCTTGGGAGCCAGTAAGTTCATGGTTCAATTGCTAGCACCATTGGGTT
GTTTACCGATCGTGAGACAAGAACATGGAACCGGCAACGACTGTTACGAGCCACTTAACGATTTGGCCAAACAACACAAC
GAGAAGATCGGTCCGATGTTGAACCAGTTTGCCAAATCCCCTGGTTTTCAGTTCACCGTCTTTGATTTCTACAACGCCAT
CCTTCGTAGGACACAGAGACCTCATAACTACCGGTTCTACATCGCGAACTCATCATGTTGCGGTGTTGGGACGCACACTG
CGTACGGTTGCGGAATGGGAAACGTTCACTCGAAACTATGTGAGTATCAAAGGTCGTATCTCTTCTTTGACGGACGTCAC
AACACAGAGAAGGCTCAAGAGGAATTAGCTCATCTGATCTATGGAGCTGACACTAATGTGATCCAACCGATGACGGTCCG
TGAGCTCATTGTGTTTCCAGCTGGAGAGAACATGCTTGAGTCTTGGGAGCCTAACTTGTCGTCGGTCCGTCGTCGTTCAT
CTACCAAATCTACATCGGTTTATCGGCTTCTTGATTTAATTGGATGA