Details for Kale Locus Bo5g130490

Position : C5 ( 5`- 40439879 .. 40441606 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130490

Protein [Map View]
MCGGAIISDFIPPSRSRRVTSEYLWPDLKNKGKASKKKKRSDFLDLDDEFEADFQGFKDGASFDCEDEFDVDDDVFADVK
PFVFAAGAKPVAYPPAAFASASAGSVSGKKTIESGGQAEKSAKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFD
TAEEAARAYDAAARRIRGNKAKVNFPEEMVPSVTHKRPAAKKPVAKPNQSPALVQQPSQYCNNSFDNMGHDSSFGDVSFM
EEKPQMYNNQFFDVGGNNGYQYFSSDQGSNSLDCSEFGWSDHTPKTPEISSMLVNSNQAPFIEETNPAKKLKTNSEDGTS
NNGNSDDLMAYLNNALWESPLEVEAMFGGDAATMTQEEGTPMDLWSLDDINSMLDGGVF*

DNA
ATGTGTGGAGGAGCTATAATCTCCGATTTCATACCTCCGTCGAGGTCCCGCCGCGTCACGAGCGAGTACCTCTGGCCGGA
TCTGAAAAACAAAGGGAAAGCTTCGAAGAAGAAGAAGCGATCCGATTTCCTCGATCTGGACGATGAGTTCGAGGCTGACT
TTCAAGGGTTTAAGGATGGTGCATCGTTCGATTGCGAAGATGAATTCGATGTGGATGATGATGTCTTCGCCGATGTCAAG
CCCTTTGTCTTCGCCGCAGGTGCCAAGCCCGTAGCTTACCCTCCCGCCGCCTTCGCCTCCGCCTCCGCTGGTTCAGTTTC
TGGCAAGAAAACCATAGAGTCTGGTGGACAAGCTGAGAAGTCTGCTAAGAGAAAGAGGAAGAATCAGTACAGGGGGATTA
GGCAGCGCCCTTGGGGCAAATGGGCCGCTGAGATCCGTGATCCTAGGAAAGGCTCCCGGGAATGGCTTGGAACATTCGAC
ACCGCTGAGGAAGCAGCAAGAGCTTATGATGCGGCTGCACGCAGGATCCGCGGCAATAAAGCTAAGGTGAACTTCCCAGA
GGAGATGGTCCCTAGCGTCACCCATAAACGCCCTGCTGCTAAGAAGCCAGTGGCCAAACCAAACCAAAGCCCAGCTTTGG
TTCAGCAGCCAAGTCAGTACTGCAACAACTCCTTTGACAACATGGGACATGACTCCTCTTTCGGTGATGTGAGTTTCATG
GAAGAGAAGCCTCAGATGTACAACAATCAGTTCTTTGATGTCGGAGGCAACAATGGATACCAGTATTTCAGTTCTGACCA
GGGCAGTAACTCACTGGACTGCTCTGAGTTTGGGTGGAGTGATCATACCCCCAAGACACCTGAGATCTCTTCAATGCTGG
TCAACAGTAACCAAGCTCCTTTCATTGAAGAAACCAATCCAGCCAAGAAGCTCAAAACCAACTCTGAGGACGGGACAAGC
AACAATGGTAATTCTGATGATCTGATGGCATATTTGAACAACGCCTTGTGGGAGTCTCCATTGGAAGTGGAAGCTATGTT
CGGTGGTGATGCTGCTACTATGACTCAGGAAGAGGGAACCCCAATGGACCTATGGAGCTTAGATGATATCAACTCCATGC
TGGATGGTGGAGTCTTCTGA