Details for Kale Locus Bo5g130450

Position : C5 ( 5`- 40403518 .. 40404497 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130450

Protein [Map View]
MDLDVLVDESYFSALFDYDEVFPISDVNYASELHLQEALFSSLIASAAKINNHPQIQRSFTTVIKQEPVVKIENEPLEPS
RRLCMICMDEKPSSDMFRGSVTCTHAYCTQCTIRYVANKIKENSAKIKCPDVDCTRSIEPYMCRDLIPKDVFERWEKILC
ESLISSWDKLYCPFKDCSSVMILDDVGGNNANVTQTECPSCHRMFCAQCKVAWHVGVGCEESQRYGNTKKKSSDEEDALL
VQMATNKQWRRCPSCKFYVEKVDGCMHIKCRCGFQFCYGCGSVWASNHACQIRT*

DNA
ATGGACCTGGATGTATTAGTAGATGAATCTTACTTCTCTGCTTTATTCGATTACGATGAAGTCTTCCCTATCTCCGACGT
TAACTACGCGTCAGAGCTTCATCTCCAAGAAGCTCTCTTCTCTTCCTTGATCGCTTCAGCGGCTAAGATCAATAACCATC
CCCAAATCCAAAGGAGTTTCACCACTGTTATCAAGCAGGAACCAGTGGTAAAAATCGAGAACGAACCCTTGGAACCATCC
AGAAGGTTATGTATGATCTGCATGGACGAAAAGCCTTCCTCCGACATGTTCCGAGGATCAGTCACATGCACTCATGCATA
CTGCACTCAGTGCACCATCCGTTACGTGGCGAACAAGATCAAAGAAAACTCAGCGAAGATCAAATGCCCTGACGTGGACT
GCACGCGTTCGATAGAGCCGTACATGTGTAGAGATCTGATCCCAAAGGACGTGTTTGAGCGTTGGGAGAAGATCTTGTGC
GAGTCGTTGATTTCTTCATGGGACAAGTTATACTGCCCGTTCAAAGACTGTTCATCTGTGATGATTCTTGACGATGTTGG
TGGTAATAATGCTAATGTGACGCAGACCGAGTGTCCATCTTGTCACAGAATGTTTTGCGCTCAATGTAAGGTGGCATGGC
ACGTGGGTGTTGGATGTGAGGAGTCCCAGAGGTATGGGAACACTAAGAAGAAGAGTAGTGATGAAGAAGATGCTTTGTTG
GTTCAAATGGCCACGAATAAGCAGTGGAGAAGGTGCCCTAGTTGCAAGTTCTACGTTGAGAAAGTCGATGGATGTATGCA
TATAAAGTGCAGGTGTGGATTTCAGTTCTGTTATGGTTGTGGATCAGTGTGGGCTTCTAATCACGCGTGCCAAATTCGTA
CCTAA