Details for Kale Locus Bo5g130440

Position : C5 ( 5`- 40402142 .. 40402767 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130440

Protein [Map View]
MAYSIKLCLPIQTPCFAPKTVRSKTLMLQQSQVQVKVNQVTVSQPQPIRYSTKKNTVFEDPIQGIICYTDDNGEVICEGY
DEGPRCPPDNSMVASYSREVEILDLLQINYQELRVAYKGDGRRQEIASQQELAMIKWSNYDFL*

DNA
ATGGCATATTCAATTAAACTCTGTCTTCCTATTCAAACACCATGTTTTGCTCCAAAGACAGTAAGATCAAAGACTTTGAT
GCTTCAACAGAGTCAGGTTCAAGTTAAAGTCAATCAAGTAACAGTTTCACAGCCTCAACCGATAAGATACTCCACCAAGA
AGAACACTGTGTTTGAAGATCCAATCCAAGGGATCATATGTTACACAGATGATAATGGAGAGGTTATATGTGAAGGGTAC
GATGAAGGTCCTCGTTGTCCACCAGACAACTCAATGGTAGCTTCTTACTCAAGAGAGGTGGAGATTCTTGATCTTCTGCA
AATAAATTATCAGGAACTGAGAGTTGCATACAAGGGTGATGGTCGAAGACAGGAAATTGCTTCACAACAAGAGTTAGCAA
TGATCAAATGGAGCAACTATGACTTCCTCTAA