Details for Kale Locus Bo5g130420

Position : C5 ( 5`- 40386784 .. 40387323 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130420

Protein [Map View]
MDELINRGIVLAFAVISIGIFSLVVSCIIKCYNIGYNDHDYESSDDQHVTITIKELASINPSILRSIPVVDFNTQGFKDG
IQCVVCLSELADGDKATVLPTCNHWFHAHCIDSWFQSHSTCPVCRNIVGLAKNHYSGFEPDESLTNSLPTTNTAVIEDSD
ETNEFQPDQICSRCGRHSY*

DNA
ATGGACGAATTAATCAATCGTGGAATTGTTCTTGCTTTTGCCGTAATTTCTATTGGGATTTTTAGTTTGGTGGTGAGTTG
TATTATTAAATGTTACAATATTGGTTACAATGATCATGACTATGAAAGCAGCGATGATCAACATGTAACTATAACCATCA
AAGAGTTGGCCAGTATCAATCCATCCATTCTTCGATCAATTCCCGTCGTAGACTTCAACACTCAAGGCTTCAAAGACGGC
ATCCAATGCGTCGTCTGTCTCTCAGAGCTTGCTGATGGAGACAAAGCTACGGTTTTGCCTACTTGTAATCATTGGTTTCA
TGCCCATTGCATCGATTCGTGGTTTCAATCTCATTCAACGTGTCCTGTCTGTAGAAACATAGTTGGTTTAGCCAAAAATC
ACTATTCAGGTTTCGAACCTGATGAGTCTCTGACCAATTCTCTTCCAACTACAAACACGGCAGTTATCGAAGACTCTGAC
GAAACAAACGAATTTCAACCAGACCAGATATGCAGCCGTTGTGGCAGACATTCTTATTAG