Details for Kale Locus Bo5g130360

Position : C5 ( 5`- 40342291 .. 40343733 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130360

Protein [Map View]
MEEEIYFPDTDLDLSFTSTVTDRTFASSSGRSSLTLSFNDRLSTSSAVTTSSTSSSTINHRRQDPHWSAIKSAKLLSSDG
NIHLRHLKLIRHLGTGNLGRVFLCNLRDSSARFALKVIDRNNLTTAKKLSQVETEAEILSLLDHPFLPTLHARIDESHYT
CLLIDYAPNGDLHSLLRKQPGNRLPLQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLSDFDLCFKSDVV
PTFKSRRYRRTSSSPSLRRRRSGCFSAAPAEEKYEREEIVSEFTAEPVTAFSRSCVGTHEYLAPELVSGNGHGSGVDWWA
FGIFLYELLYGTTPFKGDSKEQTLRNIVSTTKTVRFHVDSDLDEARDLIEKLLVKDPKKRLGCARGAQDIKRHPFFDGIK
WPLIRHYKPPEEVRGLVIKKSTRAHAGHVTAVTPRRRKSFLWRALSYILRGKSSSGGSKNQSNSNYYHYVGKSYASRKRV
*

DNA
ATGGAAGAAGAAATATATTTCCCTGACACCGATCTTGATCTCAGCTTCACATCCACCGTCACCGACCGCACATTCGCCTC
CTCAAGCGGTCGGTCCAGCCTAACCCTAAGCTTCAATGACAGGCTCTCCACTTCCTCAGCCGTTACAACCTCATCCACAT
CCTCCTCAACCATCAACCACCGTCGCCAAGATCCTCACTGGTCGGCAATCAAATCAGCTAAGCTCCTCTCCTCCGACGGA
AACATCCACCTTCGCCACCTGAAACTAATACGCCACCTCGGCACTGGAAACCTCGGCCGCGTCTTCCTATGCAACCTCCG
TGACTCCTCCGCAAGATTCGCCCTAAAAGTCATCGACCGTAACAACCTAACCACGGCCAAGAAGCTATCTCAGGTCGAGA
CGGAGGCAGAGATCCTCTCTTTGCTAGACCACCCTTTCCTCCCTACACTCCACGCTCGTATCGATGAGTCTCACTACACG
TGCCTCCTCATCGATTACGCTCCCAACGGAGACTTACATTCCTTGCTACGCAAGCAACCTGGTAACCGTTTACCGCTTCA
GCCGGTTAGATTCTTCGCCGCCGAAGTTCTCGTCGCCTTAGAGTACCTCCACGCGATGGGAATCGTGTACCGAGATCTTA
AACCGGAAAACGTTTTGCTCCGAGAGGACGGACACGTCATGCTATCGGACTTCGACCTATGTTTCAAATCCGACGTTGTC
CCCACTTTTAAATCTCGCCGCTACCGGAGAACATCCTCTTCGCCATCGCTTCGCCGGCGGCGAAGCGGTTGCTTCTCTGC
CGCACCGGCCGAGGAGAAGTACGAGAGGGAGGAGATCGTTTCAGAGTTTACTGCGGAGCCAGTGACGGCGTTTTCACGTT
CTTGCGTCGGAACACATGAGTATCTTGCGCCGGAGCTAGTCTCCGGCAACGGACACGGAAGCGGAGTAGACTGGTGGGCG
TTCGGAATATTCCTCTACGAGCTATTATACGGAACGACGCCGTTTAAAGGAGATAGTAAAGAGCAAACACTGCGCAACAT
AGTGTCGACCACTAAGACCGTGAGGTTCCACGTGGACAGTGACTTGGATGAAGCTAGGGACTTGATTGAGAAGCTTTTGG
TTAAGGACCCGAAGAAGAGGCTAGGATGCGCCAGGGGTGCGCAAGATATCAAACGGCATCCGTTCTTCGACGGGATCAAG
TGGCCGTTGATTAGGCATTATAAGCCACCGGAGGAAGTTAGAGGGCTTGTGATCAAGAAGTCGACGAGAGCACATGCTGG
TCACGTGACTGCCGTTACGCCGCGACGGAGGAAGTCGTTTTTGTGGAGGGCGTTGTCTTATATACTGCGCGGTAAAAGCT
CTAGTGGTGGGAGTAAAAATCAGAGCAATAGTAATTATTATCATTATGTAGGGAAAAGCTACGCGAGTCGCAAACGCGTT
TAA