Details for Kale Locus Bo5g130350

Position : C5 ( 5`- 40322970 .. 40323567 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130350

Protein [Map View]
MDKTDQNVNRTERTVESVLRVASMALSIASLVIMIKNSIANDFGSLSYSTLGAFKYLVTANGVCAAYSVLSAIFVIAIPC
PISKPRLWTLFLLDQVVTYAVLAAGAVSAETVYLAYKGNLNITWSSACDYYGIFCHKALVSVILTFLVSVLYVSLSFISS
YRLFSRFEAPKH*

DNA
ATGGACAAGACTGATCAAAATGTTAACCGAACGGAGAGAACGGTAGAGTCGGTCCTGAGAGTCGCATCAATGGCTCTAAG
TATTGCGAGTCTCGTGATCATGATCAAAAACTCTATCGCCAATGACTTTGGCTCTCTTTCTTACTCAACTCTTGGAGCTT
TCAAGTATTTGGTGACTGCTAATGGAGTTTGTGCGGCATATTCTGTTCTTTCTGCTATCTTTGTAATAGCCATTCCGTGT
CCTATAAGCAAGCCCAGACTCTGGACATTGTTCTTGCTTGATCAAGTGGTCACGTATGCGGTTCTAGCGGCTGGGGCTGT
ATCTGCAGAGACGGTATACTTAGCATATAAAGGAAACTTAAACATCACTTGGAGCTCTGCTTGTGATTATTATGGAATCT
TCTGTCATAAGGCACTAGTCTCAGTTATATTAACATTCCTTGTTTCTGTTCTTTACGTGTCACTTTCATTCATCTCTTCC
TATAGACTCTTTAGCAGATTCGAAGCACCTAAGCATTGA