Details for Kale Locus Bo5g130340

Position : C5 ( 5`- 40307528 .. 40307758 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130340

Protein [Map View]
MEAVKTTRFITEVAPSKLISATTREPFKNMLTTIFEEELDFDELVRATAERLSSSCPGFSSWSLGHYAKTNSLSAS*

DNA
ATGGAAGCAGTTAAGACCACCAGGTTCATCACCGAGGTGGCTCCCTCTAAGTTGATATCCGCAACGACGAGAGAACCATT
TAAGAACATGTTGACCACAATCTTCGAGGAAGAGTTGGACTTTGACGAATTAGTCAGAGCCACTGCAGAGAGACTCTCTT
CATCTTGTCCAGGCTTCTCCTCCTGGTCTCTTGGTCACTACGCCAAGACCAATAGTCTCTCTGCTTCTTAG