Details for Kale Locus Bo5g130330

Position : C5 ( 5`- 40303979 .. 40307009 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130330

Protein [Map View]
MGYKLQMSWMPSLLSQKRRNGPPLGLRNLGNTCYLNSVLQCLTYTPPLANFCLNHKHSSHCDSFVDGERKRDCPFCIVEK
RIARSLSVDHAIDAPNKISSCLKIFAEHFKFGRQEDAHEFLRYVIDACHNTSLRLKKLRTKGGGGAESVNGSSSTEVKEI
FGGAMQSQVKCLPCGAESNKADEIMDISLEISNSSSVKESLQKFFQPEILDGNNKYKCESCKKLVTARKQMSVLQAPNIL
VIQLKRFEGIYGGKIDKPITFGEILFLSTFMSKSSKDPQPEYKLFGIIVHSGYSPESGHYYAYVKDSLNRWFCCNDASVT
HSTLQEVLSEKAYILFFSRINQRPASAKNLVTTSASAKNLVTTSNGTTSHEVNGSETPRPKKFIGPLNNVSMQQPRAEQS
FKKDNNNLASSKPHQFIRPLKDANMKPREEQPFHKKNADSPQVEKAPLKPHAKISISVNLGAKRVSPTVNGRLSFDQDQD
LTPEADKENIGSVSAKRVYTCSEKKFGTENGGNGVKENGSAQASSSSSNNNEVSLHPHERSNGGDHHHKDSLYSCKSNGS
QNGTDQEEIEKDGVSKPQPKALESSTNGDDRCIFLRKDKSSRDQLEAIKESLQEDVSSYLRSCGWYDEVHKSMRAKKRLL
GELSGGDCEDGNDLKRRLIADVESSLSQIPDELKADLLQSSSVLSVITYAHIACSIPSVVMQREGIEIFPVSVK*

DNA
ATGGGATATAAGCTGCAGATGAGCTGGATGCCGAGTCTACTCAGTCAGAAGCGACGGAACGGTCCGCCTCTAGGGTTACG
GAACCTCGGCAACACGTGCTACCTCAATAGCGTCCTCCAATGTCTCACCTACACTCCTCCTCTCGCCAATTTTTGCCTCA
ATCACAAACACTCCTCTCACTGTGATTCATTTGTTGATGGTGAGAGGAAACGAGATTGTCCTTTCTGCATAGTCGAGAAA
CGAATAGCGAGGTCTCTCAGCGTCGATCACGCCATCGATGCGCCTAACAAGATCTCGAGCTGTCTCAAGATTTTCGCCGA
GCATTTTAAGTTTGGGCGTCAAGAGGACGCTCATGAGTTCTTGCGGTATGTGATCGATGCGTGCCACAATACGTCTCTTC
GTCTGAAGAAGCTGAGGACGAAGGGGGGCGGCGGCGCTGAGTCTGTTAACGGGAGTAGTAGTACTGAGGTGAAGGAGATT
TTCGGTGGTGCTATGCAGAGCCAGGTGAAGTGTTTGCCTTGTGGCGCGGAGTCTAATAAAGCGGATGAGATTATGGATAT
CAGTCTTGAGATTTCGAATAGTAGCTCGGTGAAGGAGTCGTTGCAGAAGTTCTTTCAGCCTGAGATTTTGGATGGGAACA
ATAAGTACAAATGCGAGAGTTGTAAGAAATTGGTGACGGCGAGGAAGCAAATGTCAGTACTCCAAGCACCTAATATACTT
GTCATCCAATTGAAAAGGTTTGAGGGTATTTATGGTGGGAAGATTGATAAGCCCATTACATTTGGTGAGATTCTGTTTCT
CTCCACATTCATGAGTAAATCAAGCAAGGACCCTCAACCAGAATACAAGCTTTTTGGGATAATTGTGCATTCTGGATATT
CTCCTGAATCTGGACACTATTATGCATATGTTAAGGATTCTTTGAACCGATGGTTTTGCTGCAACGATGCGTCTGTCACA
CACTCCACCTTGCAAGAGGTTTTGTCAGAAAAAGCCTACATACTCTTTTTCAGCCGTATCAACCAAAGGCCGGCTTCTGC
TAAAAATTTGGTGACAACATCGGCTTCTGCTAAAAATTTGGTGACAACATCCAACGGGACTACATCTCACGAAGTTAATG
GCTCTGAGACACCAAGGCCCAAGAAGTTTATTGGCCCCCTTAATAATGTCAGCATGCAACAACCACGAGCTGAGCAGTCC
TTCAAGAAGGATAATAATAACCTGGCTTCTTCAAAGCCCCATCAGTTTATTCGTCCTCTTAAAGATGCTAACATGAAACC
ACGAGAAGAGCAGCCTTTCCACAAGAAGAACGCTGATTCTCCCCAAGTCGAAAAGGCTCCTCTCAAGCCACATGCAAAGA
TCAGTATATCTGTCAACCTTGGTGCCAAAAGGGTATCTCCTACTGTCAACGGCAGACTTTCTTTCGACCAAGATCAGGAC
TTAACTCCAGAGGCGGACAAAGAGAATATTGGATCTGTTTCGGCAAAGAGGGTATACACTTGTTCGGAGAAAAAGTTTGG
TACTGAAAATGGTGGTAATGGAGTTAAAGAAAACGGCAGTGCACAAGCTAGTAGTAGTAGTAGTAACAATAATGAAGTGA
GCTTACATCCCCATGAGCGTAGTAATGGGGGTGATCATCACCACAAAGATAGCTTATATTCATGCAAGAGTAATGGTTCA
CAAAATGGAACTGATCAGGAGGAAATTGAGAAGGACGGTGTTAGCAAACCCCAACCCAAAGCCTTGGAGTCTTCAACAAA
TGGAGATGATCGCTGTATTTTTCTTAGGAAAGACAAATCATCTCGTGATCAACTTGAAGCAATCAAAGAGAGCCTGCAGG
AAGACGTGTCATCATATTTGCGGTCATGCGGATGGTATGATGAAGTACACAAATCGATGCGCGCCAAGAAGAGATTGCTT
GGAGAGCTGTCAGGGGGAGATTGTGAAGATGGTAACGACTTAAAGAGGAGGTTGATAGCAGATGTAGAGTCAAGTTTATC
TCAGATCCCAGATGAGTTGAAAGCTGATCTGCTACAGTCTTCCTCAGTCCTCAGTGTCATCACATACGCACATATTGCTT
GTTCCATCCCGTCGGTTGTGATGCAGCGAGAAGGGATCGAGATTTTTCCAGTGAGTGTGAAGTGA