Details for Kale Locus Bo5g130320

Position : C5 ( 5`- 40301590 .. 40303259 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130320

Protein [Map View]
MADRSRGFMRDEFVTYAYILLYIALSSGQIFFNKWVLSSKEINFPYPLGLTLLHMIFSSVLCFLLTKVLKIVKVEEGMTL
EIYVTSVIPIGAMFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEMMSCRMLLIMSIISFGVLVASYGELN
INWIGVVYQMGGVVGEALRLIFMEILVKRKGIKLNPISLMYYVSPCSAVCLFVPWIFLEKSKMDGNGPWNFHFVVLTLNS
LCTFALNLSVFLVISHTSALTIRVAGVVKDWVVVLVSALLFADTKLTVINLFGYAIAIAGVAAYNNHKLKKEASRVTSET
PGDGESIPLVSLPNTERG*

DNA
ATGGCGGATCGGAGCAGAGGATTCATGAGAGATGAATTCGTGACCTACGCTTACATTCTTCTCTACATCGCTCTTTCTAG
CGGTCAAATCTTCTTCAACAAGTGGGTTTTGTCATCTAAGGAAATAAACTTTCCTTATCCGCTTGGGTTGACTTTACTCC
ATATGATCTTCTCCTCTGTCTTGTGCTTTCTTCTTACCAAAGTTCTCAAGATCGTGAAGGTTGAGGAAGGGATGACATTA
GAAATATATGTTACATCAGTTATTCCAATAGGTGCCATGTTTGCGATGACCCTCTGGTTGGGAAACACTGCCTACCTCTA
CATCTCAGTTGCCTTTGCCCAGATGTTGAAGGCTATAATGCCTGTTGCTGTGTTTATCCTTGGAGTAGCTGCTGGGCTTG
AAATGATGAGCTGCAGGATGCTTTTGATTATGTCTATCATAAGTTTCGGCGTTTTAGTAGCCTCGTACGGGGAGTTAAAC
ATCAACTGGATCGGAGTTGTTTACCAAATGGGTGGCGTCGTTGGAGAAGCACTGAGGCTGATCTTCATGGAGATTCTTGT
CAAGAGGAAAGGCATCAAGCTAAACCCAATCTCTCTTATGTACTATGTGAGCCCCTGCAGTGCTGTTTGCTTGTTTGTGC
CGTGGATCTTTCTAGAGAAGTCGAAGATGGATGGGAATGGCCCGTGGAACTTCCATTTCGTAGTGTTGACGCTTAACTCC
CTCTGTACGTTTGCTCTCAACTTGTCGGTTTTCTTGGTGATCTCTCACACGAGCGCTCTCACTATCAGAGTCGCTGGCGT
TGTCAAGGATTGGGTGGTTGTTCTGGTCTCAGCTCTTCTCTTTGCCGACACAAAACTCACAGTCATCAATCTTTTTGGTT
ACGCCATTGCCATTGCCGGTGTAGCAGCTTATAACAACCATAAGCTGAAGAAGGAAGCATCTCGAGTTACCTCCGAAACT
CCAGGAGACGGTGAGTCGATACCGTTGGTGTCACTGCCCAATACAGAGAGAGGATGA