Details for Kale Locus Bo5g130300

Position : C5 ( 5`- 40293567 .. 40295595 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130300

Protein [Map View]
MEITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMTTTILGFKISMPIMVAPTAM
QKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPR
LGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKMPILVKGVITGEDARI
AVQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFSLAAEGE
AGVRKVLQMLRDEFELTMALSGCRSLKEITRNHITTEWDTPRPPHPSARL*

DNA
ATGGAGATCACAAACGTAACCGAGTATGAAGCGATTGCAAAGGAGAAGTTGCCTAAGATGGTATACGACTACTATGCCTC
TGGTGCAGAAGACCAATGGACTCTTCAAGAGAACAGAAACGCTTTCGCAAGAATCCTCTTTCGACCTCGGATTCTGATTG
ATGTGAGCAAGATTGATATGACAACAACCATCTTGGGTTTCAAGATCTCCATGCCCATCATGGTTGCTCCTACTGCCATG
CAGAAGATGGCTCACCCTGAAGGAGAATATGCTACGGCTAGAGCTGCCTCTGCTGCTGGAACCATCATGACACTATCTTC
ATGGGCTACTTCAAGTGTCGAGGAAGTTGCTTCCACAGGGCCAGGGATTCGTTTTTTCCAGCTCTATGTATACAAGAACA
GGAATGTCGTTGAGCAGCTGGTGAGAAGAGCCGAGAGGGCAGGGTTCAAAGCCATTGCTCTCACAGTAGACACCCCAAGG
CTAGGTCGCAGAGAGTCTGACATCAAGAACAGATTCACTTTGCCTCCAAACCTGACATTGAAGAACTTTGAAGGTCTCGA
CCTTGGAAAGATGGACGAGGCCAATGACTCTGGCTTAGCTTCATATGTTGCTGGTCAAATTGACCGTACCTTGAGCTGGA
AGGATGTCCAGTGGCTCCAGACAATCACCAAAATGCCGATTCTTGTCAAGGGTGTTATCACCGGAGAGGATGCAAGGATA
GCGGTTCAAGCTGGGGCAGCAGGGATAATAGTGTCAAACCATGGAGCTCGCCAGCTTGACTATGTCCCAGCAACAATCTC
AGCCCTTGAAGAGGTTGTCAAAGCGACACAAGGACGAATCCCTGTCTTCTTAGATGGTGGTGTTCGCCGTGGCACTGATG
TTTTCAAGGCACTTGCTCTTGGAGCCTCGGGGATATTTATTGGAAGACCAGTGGTATTCTCACTTGCTGCTGAAGGAGAG
GCTGGAGTCAGAAAGGTGCTTCAGATGCTACGTGATGAGTTCGAGCTGACAATGGCACTAAGTGGCTGCAGGTCTCTCAA
GGAAATCACCCGTAACCACATCACCACCGAATGGGACACTCCACGCCCTCCACACCCTTCGGCCAGGTTATAG