Details for Kale Locus Bo5g130290

Position : C5 ( 5`- 40292738 .. 40293064 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g130290

Protein [Map View]
MIGRRAGTNRVGMRRDDSILTRFVDSVFSLFRLAEFEILFVLFFVIAYVIFKDLTARPEYNRILVEKPRGYDMWPF*

DNA
ATGATCGGACGGCGTGCTGGAACGAATCGAGTCGGCATGAGGAGGGACGACTCCATCCTGACTCGGTTCGTCGACTCAGT
GTTTTCTCTATTCCGATTAGCTGAGTTTGAGATCCTGTTTGTGCTATTCTTCGTTATAGCCTACGTCATCTTCAAAGATC
TGACGGCGAGGCCGGAGTACAATCGGATTCTTGTTGAGAAGCCCCGCGGATATGACATGTGGCCGTTCTAG