Details for Kale Locus Bo5g129220

Position : C5 ( 5`- 40177436 .. 40179487 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g129220

Protein [Map View]
MAAITEDPTTDVVVKDVHEICIKKDAETIIDEKTEMTSHETESELKPESELDMQKLVAMFKKLNPLAKEFFPSYYSPTKK
NGETTKGIDDDLPTATKQSGEEFDSDEKKDDNNRKKRNNYSQGRKRLTGRISKAQREDSIRRTVYVSDIDQSVTEEGLAA
LFSNCGQVVDCRICGDPHSVLRFAFVEFADDQGAHEALSLGGTMLGYYPVRVLPSKTAILPVNPTFLPRSEDEREMCSRT
IYCTNIDKKVSQADMRNFFESACGEVTRLRLLGDQLHSTRIAFVEFALADSATRALNCSGMVVGSQPIRVSPSKTPVRPR
ITRPQSTN*

DNA
ATGGCTGCCATCACTGAGGATCCCACTACTGACGTTGTTGTCAAAGACGTTCATGAGATTTGTATCAAGAAAGATGCTGA
AACGATCATCGATGAAAAAACTGAGATGACCTCACACGAGACCGAGTCCGAGCTCAAACCTGAATCCGAGTTAGATATGC
AGAAGCTGGTGGCTATGTTCAAGAAACTGAATCCTTTGGCTAAGGAGTTTTTTCCCTCTTACTACAGTCCTACCAAGAAG
AACGGTGAAACTACAAAAGGTATTGATGATGATTTACCGACAGCTACGAAGCAATCTGGTGAAGAATTTGATTCTGATGA
AAAGAAGGATGACAATAACAGGAAGAAAAGAAATAATTATAGCCAAGGGAGGAAGAGGTTGACTGGAAGAATTTCAAAAG
CTCAGAGAGAGGATAGTATTAGAAGAACAGTGTATGTTTCTGACATTGACCAGAGTGTGACTGAGGAGGGTCTTGCTGCT
TTGTTTAGTAACTGTGGACAAGTTGTTGACTGTCGAATTTGTGGGGATCCACATTCAGTTCTTCGATTTGCGTTTGTGGA
GTTTGCTGATGACCAGGGCGCACATGAAGCTTTAAGCCTTGGTGGAACGATGCTCGGGTACTACCCTGTGAGGGTCTTAC
CCTCCAAAACTGCTATTCTTCCAGTGAATCCCACATTTCTTCCTAGGTCTGAAGATGAAAGGGAGATGTGTTCAAGGACA
ATTTATTGCACAAACATTGATAAAAAGGTTTCTCAAGCTGACATGAGAAACTTCTTTGAGTCAGCATGTGGTGAGGTAAC
TCGTCTAAGGCTTCTTGGGGATCAACTGCATTCAACTCGCATTGCTTTTGTTGAGTTTGCTCTGGCGGATAGTGCAACTA
GGGCACTCAATTGCAGCGGGATGGTTGTTGGATCCCAACCCATAAGGGTAAGTCCGTCAAAGACACCAGTAAGGCCACGA
ATCACTCGACCACAATCCACAAACTAG