Details for Kale Locus Bo5g129090

Position : C5 ( 5`- 40067510 .. 40067974 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g129090

Protein [Map View]
MASVQYGLDQGMETFNDELMIMSFLEEESPAENHISVTEEEEEKLNRVIRSLEVEINMSSPTIESQKTDLQEITKPGLED
DFGWLNDFDIGLVSSQNDDEMMKLCTELSYMDGVDSSVLEIEGSDYYSHINYGLTFEEPSLSLWQENNNDVVMY*

DNA
ATGGCGTCTGTTCAATATGGTTTGGATCAAGGCATGGAGACTTTCAACGATGAGCTTATGATCATGTCGTTTTTAGAAGA
AGAATCCCCAGCTGAAAATCATATCAGCGTTACCGAAGAGGAAGAAGAGAAACTAAACCGTGTAATTAGATCGTTAGAAG
TGGAGATCAACATGAGTTCTCCGACCATAGAATCTCAAAAAACGGATCTGCAAGAGATCACGAAACCCGGTCTTGAAGAT
GATTTTGGGTGGCTTAACGACTTTGATATTGGCCTGGTTTCGTCTCAAAATGATGATGAGATGATGAAATTGTGTACGGA
ACTTTCTTACATGGATGGTGTGGATAGTAGTGTTCTTGAGATTGAAGGTAGTGATTATTATTCTCATATTAACTATGGAC
TTACATTTGAGGAACCAAGTCTTTCTCTGTGGCAAGAGAATAATAATGATGTAGTTATGTATTGA