Details for Kale Locus Bo5g129070

Position : C5 ( 5`- 40038367 .. 40039584 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g129070

Protein [Map View]
MILRRLVLSATSNSNLTRSQPLSVSATRLLSSSPDRHTPSGYDEKLARLTHKDWLAPNEVLKIFETVKDPTFLIPAYRHY
SKRKDYQPTEPLYALLINKLGHAKMFDEIEHLVKALTVEEKRCRFSEGFFYSLMKVYGNSAGRINKAIDILFSMPEFGCW
PSAKSFNFILNLLVKAKLFDEIHEIFVRAPNLGVEIDGCCLNILIKGLCESGNLDSALQLLDEFPKLKSRPNVMTFSPLL
RGFCNKGEFEGAFRLLERMEKEGIEPDAITFNILISGLRRKGRVEEGVEVMERMKVRGCQPNSGTYQEVLYGLLDKKRNL
EAGEMMRKMVSWGMRPSFLSYKKMVLGLCETKDAAEVDWVLKQMVSHGFVPKTGMWWKVVGCVVVKNKDSQEVLDRIIDR
QETSG*

DNA
ATGATTCTCCGGAGACTTGTTCTGTCTGCAACATCCAACTCAAATCTCACAAGAAGCCAACCACTCTCTGTCTCCGCTAC
ACGCCTCCTCTCATCTTCTCCCGATAGACATACTCCTTCGGGTTACGACGAAAAACTCGCCAGACTAACCCACAAGGACT
GGCTAGCCCCCAACGAGGTTCTAAAAATCTTCGAAACCGTCAAAGACCCAACCTTCCTCATCCCTGCCTACCGACACTAC
TCCAAACGCAAAGACTACCAACCCACAGAGCCTCTCTACGCCCTTCTCATCAACAAGCTCGGACACGCCAAGATGTTCGA
CGAAATCGAACACCTCGTCAAAGCCCTAACCGTCGAGGAGAAACGGTGCCGTTTCTCCGAAGGGTTCTTCTACAGCCTCA
TGAAGGTTTACGGGAACTCAGCCGGGAGAATCAATAAAGCGATCGATATCCTCTTCTCCATGCCCGAGTTCGGGTGCTGG
CCGAGCGCGAAAAGCTTCAATTTTATACTGAACCTCCTCGTCAAGGCGAAGCTGTTCGACGAGATTCATGAGATCTTCGT
GAGGGCTCCTAACCTCGGCGTTGAGATCGATGGTTGTTGTTTGAATATACTTATCAAGGGGCTGTGCGAGAGTGGGAATC
TCGACTCTGCACTCCAACTGCTCGACGAATTTCCTAAACTAAAATCGCGCCCTAACGTGATGACGTTTTCTCCGTTGTTA
CGTGGGTTTTGTAATAAAGGTGAGTTTGAGGGAGCGTTTAGGTTGTTGGAGAGGATGGAGAAGGAAGGGATCGAGCCGGA
TGCTATCACGTTTAATATTCTGATCTCGGGGCTTAGGAGGAAAGGTAGGGTCGAAGAAGGGGTTGAGGTTATGGAGCGGA
TGAAGGTGAGAGGGTGTCAGCCGAATAGTGGGACTTATCAGGAGGTGTTGTATGGTTTGTTGGATAAGAAGAGGAACTTG
GAAGCTGGAGAGATGATGAGGAAGATGGTTTCTTGGGGTATGAGACCTAGTTTCTTGTCGTACAAGAAGATGGTTCTGGG
GCTTTGTGAGACGAAGGATGCTGCGGAAGTGGATTGGGTTTTGAAGCAGATGGTGAGTCATGGTTTTGTTCCGAAAACGG
GGATGTGGTGGAAAGTTGTTGGCTGTGTAGTTGTGAAGAATAAGGACTCTCAAGAAGTGTTGGATCGCATTATTGATCGC
CAGGAAACAAGTGGATAA