Details for Kale Locus Bo5g129050

Position : C5 ( 5`- 40024321 .. 40025532 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g129050

Protein [Map View]
MTSGGVVEDEKNRSVANDYQHQQQPPHPPPFQGVSNYPPPQQQPPPPGYPQPAQPYVSGYAVNGVTEHDRLPCCGIGIGW
LLFILGFFFGAIPWYIGFFLFLFSRNPREKPGYIACAIGAVIATIFIVIGAVRGSGAWS*

DNA
ATGACCAGCGGCGGCGTAGTAGAAGACGAGAAAAACAGATCAGTTGCGAATGATTATCAACACCAGCAGCAGCCTCCTCA
TCCTCCGCCGTTTCAAGGTGTCTCCAACTATCCACCTCCTCAGCAGCAGCCACCTCCCCCCGGTTATCCACAGCCAGCTC
AGCCCTACGTCTCCGGTTATGCTGTTAATGGAGTAACAGAGCACGATCGTCTTCCGTGTTGTGGAATAGGCATTGGTTGG
TTATTATTCATCCTTGGTTTCTTCTTCGGTGCCATCCCCTGGTACATCGGCTTTTTCCTTTTCCTATTCTCTAGAAACCC
GCGTGAGAAACCAGGATACATAGCTTGTGCAATTGGAGCTGTTATTGCTACGATTTTCATCGTTATTGGAGCTGTAAGAG
GATCAGGGGCCTGGTCTTAA