Details for Kale Locus Bo5g129020

Position : C5 ( 5`- 39980430 .. 39981554 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g129020

Protein [Map View]
MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIW
LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRP
PTRKLKTTYKASKPNLFM*

DNA
ATGGTTGCTTTCCGGTTTCACCAATACCAAGTGGTTGGGAGAGCACTTCCAACAGAGAAAGATGTGCAGCCTAAGATTTA
CCGTATGAAGCTTTGGGCCACTAATGAAGTTCGCGCCAAGTCCAAGTTCTGGTACTTCCTTAGGAAACTGAAGAAGGTTA
AGAAAAGCAACGGACAGATGCTTGCCATCAATGAGATTTTCGAGAAGAACCCCACGAAAATCAAGAACTACGGTATCTGG
CTCCGTTACCAGAGCCGAACCGGGTACCACAACATGTACAAGGAGTTCCGCGACACCACGCTCAACGGTGCTGTGGAGCA
GATGTACACCGAGATGGCTTCTCGCCATAGAGTGAGGTTCCCTTGCATTCAGATCATCAAGACCGCCACAGTCCCTGCAA
AACTGTGCAAGAGAGAGAGCACCAAGCAGTTCCACAACTCCAAGATCAAGTTCCCTCTTGTCTTCAGGAAGGTCAGGCCA
CCAACCAGGAAGCTCAAGACTACATACAAGGCTTCAAAGCCCAACCTTTTCATGTAA