Details for Kale Locus Bo5g128950

Position : C5 ( 5`- 39933076 .. 39933711 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g128950

Protein [Map View]
MSHLNIDMKKNSMRKNKKLVINIAAVKKEGLASRFETDQDLGSSIKNEKKRFESSERQRDVFDQRIRFKANEEIDDHGSH
DRSRVRDGVMREVDVGTGLSGALKLLREQGTFKEKSSSKHHLGVRDNHGKDDRFKDAFKDIRIDRVDEFGRILTEKEAFK
KLCHGFHGKRKQEKRMRKHEDSSKNILESSDRAVERMRQVHAELKSPYVVL*

DNA
ATGTCTCATCTCAATATTGATATGAAGAAGAATTCGATGAGGAAGAATAAGAAACTGGTTATTAATATTGCTGCTGTAAA
GAAAGAAGGTCTCGCTTCAAGATTTGAAACTGATCAGGATCTTGGTTCTTCAATAAAGAATGAGAAAAAGAGGTTTGAAT
CATCGGAGAGACAAAGAGATGTGTTTGATCAAAGGATTCGTTTCAAAGCTAATGAAGAGATTGATGATCATGGTTCCCAT
GATCGTTCTAGGGTTAGAGACGGAGTGATGCGTGAGGTCGACGTCGGTACAGGATTATCTGGGGCGTTAAAGCTTCTCAG
AGAGCAAGGAACTTTCAAGGAGAAAAGCAGCAGCAAGCATCATCTAGGTGTTAGAGACAATCATGGTAAAGATGACAGAT
TCAAAGATGCGTTTAAGGATATTAGGATTGATAGGGTGGATGAATTTGGCAGGATATTGACTGAAAAAGAAGCGTTTAAG
AAACTTTGTCATGGGTTCCATGGGAAGAGGAAGCAAGAGAAACGGATGAGGAAACATGAAGACAGCTCAAAAAATATATT
GGAGTCTTCAGATAGAGCTGTGGAAAGAATGAGACAGGTTCATGCCGAGTTGAAGAGTCCTTACGTTGTTCTTTAG