Details for Kale Locus Bo5g128930

Position : C5 ( 5`- 39918541 .. 39919658 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g128930

Protein [Map View]
MDAQYQNLPPLKRLRLMQRDLELAHQQQQKLPSQPEVKPSQLPGKKRKHSRVDYDEDCENSAPAYRCLPAKKRIWAFDPD
LLTGTPFSPFDLNVEYTPCVDEGGIEKEKKKHPPPLVESNPQEEDDKENIDPLGEEKALDLSDSIPEDEDGIMCAVCQST
DGDPSNPIVFCDGCDLMVHASCYGSPLVKAIPEGDWFCSLCTESTSLKKREKPFSCCLCTTKGGAMKPTKDGRWAHITCS
LFVPEVYFEDPEGREGICCSEIPSKRWKERCYLCKVRRGCVIECSEMKCELAFHVTCGLKEDLCIEYREGKRSGGIVVGF
CSEHTKLWERQQESGKYKIVARD*

DNA
ATGGATGCTCAGTATCAGAACTTACCTCCTCTCAAACGATTGAGATTGATGCAGCGAGATCTCGAGCTTGCGCACCAGCA
GCAGCAGAAGCTACCGAGCCAACCTGAGGTGAAGCCGTCGCAGTTGCCGGGGAAGAAGAGGAAGCATTCTCGTGTTGATT
ACGATGAAGACTGCGAGAACTCCGCCCCCGCTTACCGTTGTCTCCCGGCGAAGAAGAGGATCTGGGCGTTCGATCCAGAT
CTGCTCACCGGTACTCCCTTTTCACCTTTCGATCTGAATGTTGAGTATACGCCTTGTGTAGACGAGGGCGGAATCGAGAA
GGAGAAGAAGAAGCATCCACCTCCATTGGTTGAATCGAATCCACAAGAAGAGGATGATAAAGAGAATATTGATCCTCTAG
GGGAAGAAAAAGCTTTAGATCTCTCCGATTCGATACCTGAAGACGAAGATGGTATCATGTGTGCTGTATGTCAAAGCACA
GATGGCGATCCCTCAAATCCAATCGTCTTCTGCGACGGTTGCGACTTAATGGTCCACGCTTCGTGTTATGGTAGCCCTCT
GGTTAAAGCCATACCAGAAGGTGATTGGTTTTGCAGTCTATGTACTGAGTCAACGTCATTGAAGAAGAGAGAGAAGCCTT
TCTCTTGCTGCTTGTGTACGACCAAAGGTGGAGCCATGAAGCCCACTAAGGATGGTCGTTGGGCTCACATCACTTGCTCG
CTGTTCGTGCCGGAGGTCTACTTTGAGGATCCTGAAGGAAGGGAAGGGATTTGTTGCAGCGAGATTCCGAGTAAGAGGTG
GAAAGAGAGGTGTTATTTGTGCAAGGTTAGACGCGGGTGTGTTATCGAGTGTTCGGAGATGAAGTGTGAGCTGGCTTTTC
ATGTTACTTGTGGGTTGAAGGAAGATCTTTGCATTGAGTACCGTGAAGGCAAGAGGAGTGGTGGTATTGTTGTTGGTTTC
TGCAGTGAGCATACTAAACTTTGGGAAAGGCAACAGGAGAGTGGAAAGTACAAGATTGTTGCCAGAGATTAA