Details for Kale Locus Bo5g128920

Position : C5 ( 5`- 39916384 .. 39918021 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g128920

Protein [Map View]
MSGRNRGSYGGLQPPINQPAFVRGLGGHAPHPHPHPHPHPPRPIDDNRELPQFRNHHPQHHHSIIEDRIASQNQDVQGLL
ADNQRLAATHVALKQELEVAQHELQRMMHYIDSLRAEEDIMMREMYDKSRRCEVELHQVEALRADVQKVRADIKELTSSR
QELTSQVHLMTQDLVRLTAELQQIPTLTAEIENTKQELQRARAAIDYEKKGYAENYEHGKVMEQKLVAMARELEKLRAEI
ANSESRAHATGPVGNPGGVGYGGGYGNHDPAGYAVNPYQPNYAMNPAQAQGGVEGYYPPPYGAAPTAWAGGYDPQLQQQQ
QYYPQQGQGQG*

DNA
ATGTCCGGAAGAAATCGCGGATCGTACGGCGGCTTACAACCTCCGATCAACCAACCGGCTTTCGTCAGAGGCTTAGGAGG
ACACGCACCTCATCCTCATCCTCATCCTCATCCTCATCCCCCTCGCCCCATAGACGACAACAGGGAACTCCCCCAATTCA
GAAACCATCATCCTCAACACCACCACTCAATCATCGAAGACCGAATCGCATCTCAAAACCAAGACGTGCAGGGCTTACTC
GCCGATAACCAGAGGCTCGCCGCGACGCACGTCGCGCTTAAGCAGGAGCTGGAAGTAGCGCAGCACGAGCTGCAGAGGAT
GATGCATTATATTGATTCGTTGAGAGCCGAGGAAGATATAATGATGAGGGAGATGTACGATAAGTCTAGGCGGTGCGAAG
TGGAGCTGCATCAGGTCGAGGCGTTGCGCGCTGATGTTCAGAAGGTTAGGGCTGATATCAAGGAGCTTACTTCGAGCAGG
CAGGAGCTTACGAGTCAGGTTCATTTGATGACTCAAGATTTGGTGAGGCTCACGGCGGAGTTGCAGCAGATACCGACGTT
GACTGCGGAGATTGAGAACACTAAGCAAGAGCTGCAACGCGCAAGAGCGGCGATTGATTATGAGAAGAAAGGGTATGCGG
AGAATTACGAGCACGGGAAAGTTATGGAGCAGAAACTAGTTGCGATGGCCCGGGAACTCGAGAAGCTTCGAGCTGAGATT
GCTAACTCGGAGAGTAGAGCTCATGCTACTGGTCCTGTTGGGAATCCTGGTGGAGTTGGTTATGGTGGTGGGTATGGAAA
CCATGATCCTGCTGGGTATGCTGTGAATCCTTATCAACCCAACTATGCCATGAATCCTGCACAAGCACAGGGAGGCGTTG
AAGGCTATTATCCTCCTCCATATGGAGCAGCACCCACTGCCTGGGCGGGTGGCTATGATCCGCAGCTGCAGCAGCAACAA
CAGTATTATCCACAACAAGGACAAGGACAGGGATGA