Details for Kale Locus Bo5g128910

Position : C5 ( 5`- 39899530 .. 39900993 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g128910

Protein [Map View]
MDVFAFHGSFSMWKDVAGIAGNIFAFGLFISPMPTFRRILRNKSTEQFSGLPYIYSLLNCLICLWYGSPFISQRNLMLVT
VNSLGATFQLCYIILFIMHTDKKNKMRMLVLLLVVFAVVGLIVAGSLQIPDKLTRWYFVGFLSCASLVSMFASPLFVINL
VIRTKSVEFMPFYLSLSTFLLSGSFLLYGLFNSDAFVYTPNGIGTVLGIVQLSLYCYYHRSSIEEETKEPLIVSYV*

DNA
ATGGATGTTTTTGCTTTCCATGGTTCTTTCTCCATGTGGAAAGATGTTGCCGGAATCGCAGGCAACATATTTGCATTTGG
ACTATTCATTTCACCAATGCCAACGTTTAGGAGAATATTGAGGAACAAATCAACCGAGCAATTCTCTGGTTTACCATACA
TTTACTCTCTCTTGAACTGCTTGATCTGCCTTTGGTACGGCTCACCTTTCATATCCCAAAGAAACCTCATGCTTGTGACT
GTAAATTCCCTTGGAGCCACTTTTCAGCTTTGTTACATTATCCTCTTCATCATGCATACAGACAAGAAGAATAAGATGAG
GATGCTTGTTCTGCTTCTTGTGGTGTTTGCTGTGGTTGGATTGATTGTAGCTGGAAGTTTACAGATACCTGACAAGCTCA
CACGTTGGTACTTTGTTGGGTTCTTGAGCTGCGCTTCTCTTGTCTCCATGTTTGCCTCGCCTTTGTTTGTCATTAACTTA
GTGATTCGAACTAAGAGCGTTGAGTTTATGCCGTTTTATCTCTCTCTATCAACGTTTTTGTTGAGTGGTTCCTTCCTCCT
TTACGGGTTATTCAACAGCGACGCCTTTGTTTATACACCAAATGGAATAGGAACGGTTCTTGGTATTGTGCAGTTGTCTT
TGTACTGTTACTACCACAGGAGTTCTATAGAAGAAGAAACAAAAGAGCCTTTGATTGTTTCTTACGTGTGA